BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_O18 (227 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC064370-1|AAH64370.1| 2335|Homo sapiens PRP8 pre-mRNA processin... 160 6e-40 AY486135-1|AAS64748.1| 436|Homo sapiens apoptosis-regulated pro... 160 6e-40 AF092565-1|AAC61776.1| 2335|Homo sapiens splicing factor Prp8 pr... 160 6e-40 AB007510-1|BAA22563.1| 2335|Homo sapiens PRP8 protein protein. 160 6e-40 AY486134-1|AAS64747.1| 437|Homo sapiens apoptosis-regulated pro... 157 6e-39 BC052973-1|AAH52973.1| 1187|Homo sapiens PCDH12 protein protein. 29 3.5 BC042634-1|AAH42634.1| 1187|Homo sapiens PCDH12 protein protein. 29 3.5 AY358428-1|AAQ88794.1| 1184|Homo sapiens PCDH12 protein. 29 3.5 AK024140-1|BAB14837.1| 1187|Homo sapiens protein ( Homo sapiens ... 29 3.5 AK023785-1|BAB14677.1| 808|Homo sapiens protein ( Homo sapiens ... 29 3.5 AF240635-1|AAF73962.1| 1184|Homo sapiens vascular endothelial ca... 29 3.5 AF231025-1|AAF61931.1| 1184|Homo sapiens protocadherin 12 protein. 29 3.5 AB026893-1|BAA95162.1| 1184|Homo sapiens vascular cadherin-2 pro... 29 3.5 >BC064370-1|AAH64370.1| 2335|Homo sapiens PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae) protein. Length = 2335 Score = 160 bits (389), Expect = 6e-40 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = +2 Query: 2 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 181 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV Sbjct: 1786 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 1845 Query: 182 AALIRSLPVEEQPKQ 226 AALIRSLPVEEQPKQ Sbjct: 1846 AALIRSLPVEEQPKQ 1860 >AY486135-1|AAS64748.1| 436|Homo sapiens apoptosis-regulated protein 1 protein. Length = 436 Score = 160 bits (389), Expect = 6e-40 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = +2 Query: 2 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 181 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV Sbjct: 284 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 343 Query: 182 AALIRSLPVEEQPKQ 226 AALIRSLPVEEQPKQ Sbjct: 344 AALIRSLPVEEQPKQ 358 >AF092565-1|AAC61776.1| 2335|Homo sapiens splicing factor Prp8 protein. Length = 2335 Score = 160 bits (389), Expect = 6e-40 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = +2 Query: 2 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 181 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV Sbjct: 1786 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 1845 Query: 182 AALIRSLPVEEQPKQ 226 AALIRSLPVEEQPKQ Sbjct: 1846 AALIRSLPVEEQPKQ 1860 >AB007510-1|BAA22563.1| 2335|Homo sapiens PRP8 protein protein. Length = 2335 Score = 160 bits (389), Expect = 6e-40 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = +2 Query: 2 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 181 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV Sbjct: 1786 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 1845 Query: 182 AALIRSLPVEEQPKQ 226 AALIRSLPVEEQPKQ Sbjct: 1846 AALIRSLPVEEQPKQ 1860 >AY486134-1|AAS64747.1| 437|Homo sapiens apoptosis-regulated protein 2 protein. Length = 437 Score = 157 bits (381), Expect = 6e-39 Identities = 74/75 (98%), Positives = 74/75 (98%) Frame = +2 Query: 2 YRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 181 YRVTIHKTFEGNLTTKPINGAIFIFN RTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV Sbjct: 285 YRVTIHKTFEGNLTTKPINGAIFIFNTRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEV 344 Query: 182 AALIRSLPVEEQPKQ 226 AALIRSLPVEEQPKQ Sbjct: 345 AALIRSLPVEEQPKQ 359 >BC052973-1|AAH52973.1| 1187|Homo sapiens PCDH12 protein protein. Length = 1187 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 65 IFIFNPRTGQLFLKIIHTSVWAGQK 139 +FI NP TGQLF+ + + S G + Sbjct: 646 LFILNPHTGQLFVNVTNASSLIGSE 670 >BC042634-1|AAH42634.1| 1187|Homo sapiens PCDH12 protein protein. Length = 1187 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 65 IFIFNPRTGQLFLKIIHTSVWAGQK 139 +FI NP TGQLF+ + + S G + Sbjct: 646 LFILNPHTGQLFVNVTNASSLIGSE 670 >AY358428-1|AAQ88794.1| 1184|Homo sapiens PCDH12 protein. Length = 1184 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 65 IFIFNPRTGQLFLKIIHTSVWAGQK 139 +FI NP TGQLF+ + + S G + Sbjct: 646 LFILNPHTGQLFVNVTNASSLIGSE 670 >AK024140-1|BAB14837.1| 1187|Homo sapiens protein ( Homo sapiens cDNA FLJ14078 fis, clone HEMBB1002044, moderately similar to Mus musculus mRNA for vascular cadherin-2. ). Length = 1187 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 65 IFIFNPRTGQLFLKIIHTSVWAGQK 139 +FI NP TGQLF+ + + S G + Sbjct: 646 LFILNPHTGQLFVNVTNASSLIGSE 670 >AK023785-1|BAB14677.1| 808|Homo sapiens protein ( Homo sapiens cDNA FLJ13723 fis, clone PLACE2000458, weakly similar to CADHERIN-RELATED TUMOR SUPPRESSOR PRECURSOR. ). Length = 808 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 65 IFIFNPRTGQLFLKIIHTSVWAGQK 139 +FI NP TGQLF+ + + S G + Sbjct: 270 LFILNPHTGQLFVNVTNASSLIGSE 294 >AF240635-1|AAF73962.1| 1184|Homo sapiens vascular endothelial cadherin 2 protein. Length = 1184 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 65 IFIFNPRTGQLFLKIIHTSVWAGQK 139 +FI NP TGQLF+ + + S G + Sbjct: 646 LFILNPHTGQLFVNVTNASSLIGSE 670 >AF231025-1|AAF61931.1| 1184|Homo sapiens protocadherin 12 protein. Length = 1184 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 65 IFIFNPRTGQLFLKIIHTSVWAGQK 139 +FI NP TGQLF+ + + S G + Sbjct: 646 LFILNPHTGQLFVNVTNASSLIGSE 670 >AB026893-1|BAA95162.1| 1184|Homo sapiens vascular cadherin-2 protein. Length = 1184 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 65 IFIFNPRTGQLFLKIIHTSVWAGQK 139 +FI NP TGQLF+ + + S G + Sbjct: 646 LFILNPHTGQLFVNVTNASSLIGSE 670 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,872,476 Number of Sequences: 237096 Number of extensions: 608282 Number of successful extensions: 1377 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1377 length of database: 76,859,062 effective HSP length: 54 effective length of database: 64,055,878 effective search space used: 1345173438 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -