BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_O17 (602 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) 179 2e-45 SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) 128 3e-30 SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) 110 7e-25 SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) 109 2e-24 SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) 106 2e-23 SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) 93 1e-19 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 85 6e-17 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 7e-17 SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) 83 2e-16 SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) 58 5e-09 SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) 58 7e-09 SB_57663| Best HMM Match : UQ_con (HMM E-Value=0.24) 50 2e-06 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) 45 4e-05 SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) 41 7e-04 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 40 0.002 SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) 40 0.002 SB_20040| Best HMM Match : DUF293 (HMM E-Value=2.9) 31 0.72 SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_40772| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_47019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 29 3.8 SB_292| Best HMM Match : HEAT (HMM E-Value=4.6e-29) 28 5.1 SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_16261| Best HMM Match : VPR (HMM E-Value=0.77) 28 6.7 SB_18195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_4636| Best HMM Match : FGGY_N (HMM E-Value=7.3e-06) 28 6.7 SB_11967| Best HMM Match : Pollen_allerg_2 (HMM E-Value=1.7) 27 8.8 >SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 226 Score = 179 bits (435), Expect = 2e-45 Identities = 85/149 (57%), Positives = 103/149 (69%) Frame = +1 Query: 55 NNQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFP 234 N A KRI REL ++ DPP CSAGP G+DL+ W +TI+GP S Y+GGVFFL IHFP Sbjct: 92 NQSTAAKRIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDIHFP 151 Query: 235 TDYPFKPPKVAFTTRIYHPNINSNGSICLDILRAQWSPALTISKVLLSICSLLCDPNPDD 414 +DYPFKPPK G +CLDIL+ WSPALTISKVLLSICSLL D NP D Sbjct: 152 SDYPFKPPK---------------GMVCLDILKDSWSPALTISKVLLSICSLLTDCNPAD 196 Query: 415 PLVPEIARIYKTDREQYNELAREWTRKYA 501 PLV IA +Y +R +++ A+EWT++YA Sbjct: 197 PLVGSIAALYVQNRSEHDATAKEWTKRYA 225 >SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) Length = 190 Score = 128 bits (309), Expect = 3e-30 Identities = 59/115 (51%), Positives = 78/115 (67%), Gaps = 4/115 (3%) Frame = +1 Query: 172 IMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL----RAQ 339 ++G +PY G+F L I P YPF+PPKV F T IYHPNI+S+G ICLD L + Sbjct: 2 LIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGM 61 Query: 340 WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREQYNELAREWTRKYAM 504 W PAL IS VL +I L+ +PNPDDPL+ EI+ +K ++ Q+ E A+EWT K+AM Sbjct: 62 WKPALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQFLEKAKEWTLKFAM 116 >SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) Length = 145 Score = 110 bits (265), Expect = 7e-25 Identities = 47/118 (39%), Positives = 75/118 (63%), Gaps = 1/118 (0%) Frame = +1 Query: 148 DLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDI 327 ++ +WQ I+ P PY G F + I FP +YPFKPPK+ F T+IYHPNI+ G +CL I Sbjct: 22 NILYWQGLIV-PEMPPYNKGAFRIEICFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPI 80 Query: 328 LRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREQYNELAREWTRKY 498 + + W PA +V+ ++ +L+ DP P+ PL ++A Y D++++ + A + T+KY Sbjct: 81 ISPENWKPATKTEQVIQALLALVHDPEPEHPLRADLAEEYSKDKKKFMKNAEDCTKKY 138 >SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) Length = 204 Score = 109 bits (261), Expect = 2e-24 Identities = 50/91 (54%), Positives = 65/91 (71%), Gaps = 4/91 (4%) Frame = +1 Query: 244 PFKPPKVAFTTRIYHPNINSNGSICLDILR----AQWSPALTISKVLLSICSLLCDPNPD 411 PF+PPKV F T IYHPNI+S+G ICLD L+ W PAL IS VL +I L+ +PNPD Sbjct: 40 PFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPD 99 Query: 412 DPLVPEIARIYKTDREQYNELAREWTRKYAM 504 DPL+ EI+ +K ++ Q+ E A+EWT K+AM Sbjct: 100 DPLMAEISNEFKYNKAQFLEKAKEWTLKFAM 130 >SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) Length = 200 Score = 106 bits (254), Expect = 2e-23 Identities = 44/69 (63%), Positives = 52/69 (75%) Frame = +1 Query: 55 NNQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFP 234 N A KRI REL ++ DPP CSAGP G+DL+ W +TI+GP S Y+GGVFFL IHFP Sbjct: 132 NQSTAAKRIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDIHFP 191 Query: 235 TDYPFKPPK 261 +DYPFKPPK Sbjct: 192 SDYPFKPPK 200 >SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) Length = 46 Score = 93.5 bits (222), Expect = 1e-19 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +1 Query: 370 LLSICSLLCDPNPDDPLVPEIARIYKTDREQYNELAREWTRKYAM 504 LLSICSLLCDPNPDDPLVP+IARIYKTD+ +YNELA+EWT+KYAM Sbjct: 2 LLSICSLLCDPNPDDPLVPDIARIYKTDKPKYNELAKEWTKKYAM 46 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 84.6 bits (200), Expect = 6e-17 Identities = 45/145 (31%), Positives = 72/145 (49%), Gaps = 14/145 (9%) Frame = +1 Query: 67 ALKRINRELQDLGRDPPAQCSAG-PHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDY 243 A++ + EL+ L +P + P + F W I GP + Y GG F + FP DY Sbjct: 1125 AVRALQLELKKLTEEPVEGFTVEVPDESNTFEWDVAIFGPPGTLYAGGYFKAHMSFPHDY 1184 Query: 244 PFKPPKVAFTTRIYHPNINSNGSICLDILR-------------AQWSPALTISKVLLSIC 384 P+ PP F T+++HPNI +G +C+ IL +W+P + +LLS+ Sbjct: 1185 PYSPPTFRFLTKMWHPNIYESGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVI 1244 Query: 385 SLLCDPNPDDPLVPEIARIYKTDRE 459 SLL +PN P + + +++ RE Sbjct: 1245 SLLNEPNTFSPANVDASVMFRKWRE 1269 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 84.2 bits (199), Expect = 7e-17 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 14/121 (11%) Frame = +1 Query: 97 DLGRDPPAQCSAGPHG-EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFT 273 +L + P SAG EDL+ W+ ++GP + Y+ G F ++ FP +YP +PP + F Sbjct: 343 ELQKKPVEGFSAGLFDDEDLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPPTLTFI 402 Query: 274 TRIYHPNINSNGSICLDILR-------------AQWSPALTISKVLLSICSLLCDPNPDD 414 + I+HPN++ NG +C+ IL +W P T+ ++LS+ S+L +PN + Sbjct: 403 SDIWHPNVHKNGEVCISILHEPGEDKYGYEKADERWRPIHTVETIMLSVISMLAEPNDES 462 Query: 415 P 417 P Sbjct: 463 P 463 >SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) Length = 181 Score = 82.6 bits (195), Expect = 2e-16 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +1 Query: 127 SAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 282 SAGP G+ L+ W +TI+GP S Y+GGVFFL IHFPTDYPFKPPKV R+ Sbjct: 43 SAGPKGDKLYEWYSTILGPPGSVYEGGVFFLDIHFPTDYPFKPPKVGQAIRL 94 >SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 67.7 bits (158), Expect = 7e-12 Identities = 45/144 (31%), Positives = 70/144 (48%) Frame = +1 Query: 70 LKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPF 249 +K++ RE+ L DPP + ED+ QA+I GP FFLT Sbjct: 107 IKQVAREIHGLTNDPPEGIKVFSNDEDITDIQASIEGPR--------FFLT--------- 149 Query: 250 KPPKVAFTTRIYHPNINSNGSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVPE 429 +I+HPN+ NG IC++ L+ W P L I +VLL++ LL PNP+ L E Sbjct: 150 ---------KIFHPNVAKNGEICVNTLKKDWKPDLGIKQVLLTVKCLLIVPNPESALNEE 200 Query: 430 IARIYKTDREQYNELAREWTRKYA 501 ++ + Y++ A+ +T +A Sbjct: 201 AGKLLLERYDDYSKRAKMFTEIHA 224 >SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 5/70 (7%) Frame = +1 Query: 136 PHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTR-----IYHPNIN 300 P +D+ A I GP D+PY+GG F+ I P DYP +PP+V T ++PN+ Sbjct: 5 PDKDDIPKIHALITGPFDTPYEGGFFYFLIRCPPDYPIRPPRVKLMTTGSGQVRFNPNLY 64 Query: 301 SNGSICLDIL 330 NG +CL I+ Sbjct: 65 RNGKVCLSII 74 >SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 59.7 bits (138), Expect = 2e-09 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 3/112 (2%) Frame = +1 Query: 67 ALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYP 246 A+KR+ RE ++L R+ A P ++LF W T+ GP D+ + GG + I P +YP Sbjct: 11 AVKRLMREAKEL-RNATELYHAQPLEDNLFEWHFTVRGPPDTEFAGGRYHGRIILPPEYP 69 Query: 247 FKPPKVAFTTRIYHPNINSNGSICLDILR---AQWSPALTISKVLLSICSLL 393 KPP + T + ICL + W P+ +I VL++I + Sbjct: 70 MKPPSIMLLTP--NGRFEIGKKICLSMSAHHPETWQPSWSIRTVLMAIIGFM 119 >SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) Length = 215 Score = 58.0 bits (134), Expect = 5e-09 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 1/83 (1%) Frame = +1 Query: 181 PVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNIN-SNGSICLDILRAQWSPALT 357 P D Y+GG F ++ DYP PP IYHPN++ +GS+CL +L W+ + Sbjct: 45 PTDGAYRGGQFKFSVK-TEDYPNTPPVPRCVNNIYHPNMDLDDGSVCLSLL-DDWNESND 102 Query: 358 ISKVLLSICSLLCDPNPDDPLVP 426 + ++ + L +PN +DPL P Sbjct: 103 LEDLVQGLLFLFYNPNLEDPLSP 125 >SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) Length = 243 Score = 57.6 bits (133), Expect = 7e-09 Identities = 26/80 (32%), Positives = 43/80 (53%) Frame = +1 Query: 181 PVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRAQWSPALTI 360 P D Y+GG F ++ TDYP P + T+IYHPN++ +C+ +L W + + Sbjct: 45 PTDGAYRGGQFKFSVR-TTDYPNVAPSINCKTKIYHPNMDGYDGVCMSLL-DDWQASNDL 102 Query: 361 SKVLLSICSLLCDPNPDDPL 420 ++ + L +PN +DPL Sbjct: 103 EDLVQGLLFLFYNPNLEDPL 122 >SB_57663| Best HMM Match : UQ_con (HMM E-Value=0.24) Length = 48 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = +1 Query: 337 QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREQ 462 +WSPAL I VLLSI +LL PNPDDPL ++A +K + Q Sbjct: 2 KWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKVNEVQ 43 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 48.0 bits (109), Expect = 6e-06 Identities = 37/111 (33%), Positives = 53/111 (47%), Gaps = 10/111 (9%) Frame = +1 Query: 73 KRINRELQDLGRDPPAQCSAGPHGEDLFHWQA---TIMGPV----DSPYQGGVF-FLTIH 228 KR+ +E QD+ R SA ++LF W TI G D G F L I Sbjct: 737 KRLMKEFQDVSRKTERIFSAELVDDNLFEWNVKLHTIDGDSLLYRDMVETGSKFILLNIT 796 Query: 229 FPTDYPFKPPKV-AFTTRIYHPNINSNGSICLDILRAQ-WSPALTISKVLL 375 FP ++PF PP + RI + G+IC+++L + WS A T+ V+L Sbjct: 797 FPENFPFAPPFMRVLAPRIEGGFVLDGGAICMELLTPKGWSSAYTVEAVVL 847 >SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) Length = 123 Score = 45.2 bits (102), Expect = 4e-05 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +1 Query: 145 EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT 276 ++LF W T+ GP D+ + GG + I P +YP KPP + T Sbjct: 1 DNLFEWHFTVRGPPDTEFAGGRYHGRIILPPEYPMKPPSIMLLT 44 >SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +1 Query: 178 GPVDSPYQGGVFFLTIHFPTDYPFKPPKVA-FTTRI 282 GPV +PY+GGV+ + + P YPFK P +A FT I Sbjct: 56 GPVGTPYEGGVWKVRVDLPEKYPFKSPSIANFTIEI 91 >SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) Length = 55 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +1 Query: 163 QATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT 276 +A + GPVD+PY G F I FP YP PP V T Sbjct: 9 RALVTGPVDTPYSRGCFVFDIFFPGTYPNVPPLVKLIT 46 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 172 IMGPVDSPYQGGVFFLTIHFPTDYPFKPPK 261 I GP ++P++GG + L I P YPF PPK Sbjct: 693 IRGPPETPFEGGTYNLDIVIPETYPFNPPK 722 >SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) Length = 739 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +1 Query: 160 WQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI---YHPNINSNGSICL 321 ++ I GP +PY G+F I P +YP PP + + +PN+ +G +C+ Sbjct: 636 FRVMIEGPAGTPYDHGLFAFDILLPANYPDAPPSFHYLSMCNGRLNPNLYEDGKVCI 692 >SB_20040| Best HMM Match : DUF293 (HMM E-Value=2.9) Length = 646 Score = 31.1 bits (67), Expect = 0.72 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 246 WIICREMYGQKEYSSLIRAVNWTHNCGLPMKQI 148 W+ R + G E++ L A+ WTH GLP+ ++ Sbjct: 407 WLQERLIEGLLEFNDLDEAIRWTHFYGLPLDRV 439 >SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 196 YQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNG 309 ++ ++ L I +YP KPP V F ++I +NS G Sbjct: 3 FENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSKG 40 >SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 196 YQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNG 309 ++ ++ L I +YP KPP V F ++I +NS G Sbjct: 3 FENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSKG 40 >SB_40772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 241 YPFKPPKVAFTTRIYHPNINSNG 309 +P P V FT+ ++HP I+ NG Sbjct: 118 FPDSRPLVKFTSNVFHPQIHENG 140 >SB_47019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = +1 Query: 82 NRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSP--YQGGVFFLTIHFPTDYPFKP 255 ++E++++ + PP G G + W + +DS + G+ + TD F+ Sbjct: 89 DKEIENIRKPPPPLVPLGRQGTECKTWLRMQLHDIDSDVRMRSGLRMKGTYNDTDIDFEE 148 Query: 256 PKVAFTTRIY 285 A TTR+Y Sbjct: 149 ISKAETTRLY 158 >SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) Length = 980 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 145 EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYP 246 E+ F W + ++ VDS + GGV+ L + P P Sbjct: 186 EESFQWMSHVLPAVDSIHSGGVYCLCLVPPGGLP 219 >SB_292| Best HMM Match : HEAT (HMM E-Value=4.6e-29) Length = 1239 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 343 SPALTISKVLLSICSLLCDPNPD--DPLVPEIARIYK 447 S +LTISK + IC LL DPN + + + IY+ Sbjct: 116 SSSLTISKFVPHICKLLGDPNSQVRERAIDTLVEIYR 152 >SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 221 PYISLQIIHLNHQKLHSQHVFTILT*TVMVPFAWTFCVHNGH 346 PYIS+ I L ++ H QH+ TI+T ++ T+ H+ H Sbjct: 291 PYISIINISLKNRHHHHQHI-TIITVNILPSPPSTYYHHHHH 331 >SB_16261| Best HMM Match : VPR (HMM E-Value=0.77) Length = 98 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +2 Query: 80 LIGNYKIWEEI-HQHNVPQDHTAKICFIGKPQLWVQLTAL 196 ++ N+ +W I H+ +P +H IC+ + Q + +LT+L Sbjct: 39 MVMNHDVWRYIVHEKGIPSEHKGHICY--QKQDFSRLTSL 76 >SB_18195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +2 Query: 80 LIGNYKIWEEI-HQHNVPQDHTAKICFIGKPQLWVQLTAL 196 ++ N+ +W I H+ +P +H IC+ + Q + +LT+L Sbjct: 221 MVMNHDVWRYIVHEKGIPSEHKGHICY--QKQDFSRLTSL 258 >SB_4636| Best HMM Match : FGGY_N (HMM E-Value=7.3e-06) Length = 512 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 427 EIARIYKTDREQYNELAR 480 +IA+IY+T RE YNE R Sbjct: 171 QIAKIYQTKRESYNECER 188 >SB_11967| Best HMM Match : Pollen_allerg_2 (HMM E-Value=1.7) Length = 1815 Score = 27.5 bits (58), Expect = 8.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 382 CSLLCDPNPDDPLVPE 429 C + DPNP DP +P+ Sbjct: 1311 CGTITDPNPKDPYIPD 1326 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,495,069 Number of Sequences: 59808 Number of extensions: 501294 Number of successful extensions: 1375 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1366 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -