BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_O05 (550 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40942.1 68418.m04973 ribonucleoside-diphosphate reductase sm... 31 0.51 At5g05970.1 68418.m00661 transducin family protein / WD-40 repea... 28 0.66 At1g77270.1 68414.m08999 expressed protein 29 1.5 At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type f... 29 2.7 At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type f... 29 2.7 At5g26920.1 68418.m03210 calmodulin-binding protein similar to c... 28 3.6 At3g14850.2 68416.m01876 expressed protein 28 3.6 At3g14850.1 68416.m01877 expressed protein 28 3.6 At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly ... 27 6.2 At5g58080.1 68418.m07268 two-component responsive regulator fami... 27 8.3 At5g42190.1 68418.m05135 E3 ubiquitin ligase SCF complex subunit... 27 8.3 At3g51560.1 68416.m05646 disease resistance protein (TIR-NBS-LRR... 27 8.3 At3g48500.1 68416.m05294 expressed protein 27 8.3 At2g39770.1 68415.m04883 GDP-mannose pyrophosphorylase (GMP1) i... 27 8.3 >At5g40942.1 68418.m04973 ribonucleoside-diphosphate reductase small chain, putative / ribonucleotide reductase, putative similar to ribonucleotide reductase R2 [Nicotiana tabacum] GI:1044912; contains Pfam profile PF00268: Ribonucleotide reductase, small chain Length = 231 Score = 31.1 bits (67), Expect = 0.51 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 525 GFRLVFHNLHS-VVARTRVFDAQARVRLCGAIQQARVAVSDAVATA 391 GF++ N+HS ++ RT+ + + + +C A++ R V DA++ A Sbjct: 101 GFQIAIENIHSEILLRTKFDEDRLKAIVCDAVEIEREFVCDALSCA 146 >At5g05970.1 68418.m00661 transducin family protein / WD-40 repeat family protein contains similarity to regulatory protein Nedd1; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak)|19804256|gb|AV785466.1|AV785466 Length = 781 Score = 27.9 bits (59), Expect(2) = 0.66 Identities = 22/80 (27%), Positives = 34/80 (42%) Frame = +1 Query: 229 PVCGTDGNTYPNKCSLECSRPLAPSLEMKHRGECQEVKVADIQPCICTREIKQVCGSDGV 408 PV G DG +C S S + G Q VK+ D+Q +C +++K G Sbjct: 81 PVTGKDGGDSAEECLSAISFSKKGSRYICSGGTGQIVKIWDLQRKLCIKKLK---GHTST 137 Query: 409 TYGNPCLLNCATQSNPSLSI 468 G + NC + S+S+ Sbjct: 138 ITG--VMYNCKDEHLASVSV 155 Score = 21.4 bits (43), Expect(2) = 0.66 Identities = 6/21 (28%), Positives = 12/21 (57%) Frame = +1 Query: 184 TCEEADPCVCTFIYAPVCGTD 246 + + DPCV ++ +P C + Sbjct: 27 SADSGDPCVLSYTPSPGCAVN 47 >At1g77270.1 68414.m08999 expressed protein Length = 682 Score = 29.5 bits (63), Expect = 1.5 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +3 Query: 3 RYISDRRCANIRRNSAAVVMRVRKKLKTGL-RIRRQDLPQPVPLVLREGQDAQRFENRE 176 RY+ D + N R + + + R K+LKT + R + + P+V + +D QR +NRE Sbjct: 391 RYVRDSQEKNTRNDESQTIFRASKRLKTEIGRADHNSISKTNPVV--KTKDIQR-KNRE 446 >At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 144 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 52 PSSCA--CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 192 P+SC C R PVCG D TY C D +++VK+G C+ Sbjct: 68 PASCPVQCFRP-DPVCGEDSVTYWCGC-----ADALCHGVRVVKQGACD 110 Score = 27.5 bits (58), Expect = 6.2 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +1 Query: 313 KHRGE-CQEVKVADIQPCICTREIKQVCGSDGVTYGNPCLLNCATQSNPSLSIEHPGPCD 489 K+RGE C+ + P C R VCG D VTY C CA + + G CD Sbjct: 56 KNRGEFCEGIAKPASCPVQCFRP-DPVCGEDSVTYW--C--GCADALCHGVRVVKQGACD 110 >At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 117 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 85 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 192 PVCG+DG TY C D ++VK+G C+ Sbjct: 53 PVCGTDGVTYWCGC-----PDAACHGARVVKKGACD 83 >At5g26920.1 68418.m03210 calmodulin-binding protein similar to calmodulin-binding protein TCB60 GI:1698548 from [Nicotiana tabacum] Length = 492 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 517 VGFPQPSLCCRKDPGVRCSSSGS 449 VG PQ SL C +DPG + SGS Sbjct: 301 VGHPQRSLQCPQDPGFVVTCSGS 323 >At3g14850.2 68416.m01876 expressed protein Length = 321 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 403 GVTYGNPCLLNCATQSNPSLSIEHPGPCDNRVKVVE 510 GV +G P +C Q P L ++PG V V++ Sbjct: 223 GVLWGEPAAKSCVGQKEPLLGTKYPGGLPAEVGVLK 258 >At3g14850.1 68416.m01877 expressed protein Length = 253 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 403 GVTYGNPCLLNCATQSNPSLSIEHPGPCDNRVKVVE 510 GV +G P +C Q P L ++PG V V++ Sbjct: 155 GVLWGEPAAKSCVGQKEPLLGTKYPGGLPAEVGVLK 190 >At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly identical to SP|P15455 [Plant Mol Biol 11:805-820 (1988)]; contains Pfam profile PF00190 Cupin and Prosite 11-S plant seed storage proteins signature PS00305 Length = 472 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 223 YAPVCGTDGNTYPNKCSLECSRPLAPSLEMKHRGECQEVKVAD 351 YA G G +PN+C L+ L PS +K E ++V D Sbjct: 21 YAAQQGQQGQQFPNECQLDQLNALEPSHVLK--SEAGRIEVWD 61 >At5g58080.1 68418.m07268 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain Length = 581 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 433 NCATQSNPSLSIEHPGPCDNRV 498 NC +NP +IE+P P DN V Sbjct: 477 NCTMLNNPFGNIEYPLPADNMV 498 >At5g42190.1 68418.m05135 E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At2) / UFO-binding protein (UIP2) E3 ubiquitin ligase; skp1b; identical to UIP2 GI:3719211 from [Arabidopsis thaliana]; contains Pfam profiles PF01466: Skp1 family, dimerisation domain and PF03931:Skp1 family, tetramerisation domain; identical to cDNA UFO binding protein UIP2 mRNA, partial cds GI:3719210 Length = 171 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 50 CRRHARAQET*DRSADQTARLTTTSAS 130 C+RH A E + +AD A TTT+ + Sbjct: 60 CKRHVEAAEKSETTADAAAATTTTTVA 86 >At3g51560.1 68416.m05646 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1253 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 404 PSLPQTCLISRVQIHGCISATLTSW 330 P+LPQ+ + + +HGC+S SW Sbjct: 983 PALPQS--LKLLNVHGCVSLESVSW 1005 >At3g48500.1 68416.m05294 expressed protein Length = 668 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 217 FIYAPVCGTDGNTYPNKCSLECSRPLAP 300 F + P+ DG+T P++ +C RP P Sbjct: 354 FDFPPIFHRDGDTNPDEIRRDCGRPPEP 381 >At2g39770.1 68415.m04883 GDP-mannose pyrophosphorylase (GMP1) identical to GDP-mannose pyrophosphorylase from Arabidopsis thaliana [GI:3598958]; updated per Conklin PL et al, PNAS 1999, 96(7):4198-203 Length = 361 Score = 27.1 bits (57), Expect = 8.3 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 374 RVQIHGCISATLTSWHS 324 R++ H CIS+++ WHS Sbjct: 297 RIKKHACISSSIIGWHS 313 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,512,263 Number of Sequences: 28952 Number of extensions: 273458 Number of successful extensions: 885 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -