BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_O03 (585 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38320.1 68415.m04708 expressed protein 29 2.3 At2g23600.1 68415.m02816 hydrolase, alpha/beta fold family prote... 29 2.3 At1g28520.1 68414.m03506 expressed protein 29 2.3 At2g23590.1 68415.m02815 hydrolase, alpha/beta fold family prote... 29 3.0 At4g33380.1 68417.m04745 expressed protein 27 7.0 At4g14900.1 68417.m02288 hydroxyproline-rich glycoprotein family... 27 9.2 At3g16620.1 68416.m02124 chloroplast outer membrane protein, put... 27 9.2 >At2g38320.1 68415.m04708 expressed protein Length = 410 Score = 29.1 bits (62), Expect = 2.3 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +3 Query: 42 MLDKTRKSKMDYVRQSVCNGPETFSVCCGPPPEINPEDMTLNERCSRAVTAFPLESN 212 +L++ R +M YV S+ G VC NP+ M ++ S +T LE N Sbjct: 120 LLERLRNKRMVYVGDSLNRGQWVSMVCMVSSVITNPKAMYMHNNGSNLITFKALEYN 176 >At2g23600.1 68415.m02816 hydrolase, alpha/beta fold family protein similar to ethylene-induced esterase [Citrus sinensis] GI:14279437, polyneuridine aldehyde esterase [Rauvolfia serpentina] GI:6651393; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 263 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 276 ITQYPWLVVIEYESFDHMKLLCGGSLISSKYVLTA 380 I YP +VIE E DHM + C L+S + A Sbjct: 225 IHNYPANLVIEMEETDHMPMFCKPQLLSDHLLAIA 259 >At1g28520.1 68414.m03506 expressed protein Length = 486 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +3 Query: 396 GAILIEGTPKNVRLGEYNTTNNGPDCMKGTKDCAHPVVTAPIEKTI 533 G + E P+N NTTNN C+KG + V T ++ T+ Sbjct: 419 GRLTAEFPPEN---NTTNTTNNNKRCIKGRPKVSTKVATGNVQNTV 461 >At2g23590.1 68415.m02815 hydrolase, alpha/beta fold family protein similar to ethylene-induced esterase [Citrus sinensis] GI:14279437, polyneuridine aldehyde esterase [Rauvolfia serpentina] GI:6651393; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 272 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 276 ITQYPWLVVIEYESFDHMKLLCGGSLISSKYVLTA 380 I YP +VIE E DH+ L C L+S + A Sbjct: 234 IDNYPPNLVIEMEGTDHLPLFCKPQLLSDHLLAIA 268 >At4g33380.1 68417.m04745 expressed protein Length = 328 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +2 Query: 332 AAMRW-LTHQFEVRAHCCTLC 391 AA+RW LTH E A CC C Sbjct: 229 AAVRWGLTHHKESAADCCQAC 249 >At4g14900.1 68417.m02288 hydroxyproline-rich glycoprotein family protein Length = 532 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = -3 Query: 424 FGVPSIKIAPVTQCAAVSTYFELMSEPPHSSFI*SKLSYSITTSHGYWVIFVSFPP 257 +GVP+ +P T + S ++ E H S+ S +SY T++G + V+ PP Sbjct: 460 YGVPAYTTSPPTIYSNRSPPYQYSPEAVHGSYQTSPVSY--PTAYGTYCSPVAAPP 513 >At3g16620.1 68416.m02124 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 1089 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +3 Query: 96 NGPETFSVCCGPPPEINPEDMTLNERCSRAVTAFPLESNNECCGVEDTVVNK 251 N E F G + PE + + FPL SN+E C +E+T N+ Sbjct: 36 NEEEVFEEAIGSQEGLKPESL----KTDVLQEDFPLASNDEVCDLEETSRNE 83 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,789,488 Number of Sequences: 28952 Number of extensions: 300091 Number of successful extensions: 810 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -