BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_O02 (567 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX538345-1|CAD98108.1| 1582|Homo sapiens hypothetical protein pr... 34 0.30 X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila F... 33 0.93 BX537840-1|CAD97851.1| 2150|Homo sapiens hypothetical protein pr... 30 4.9 BC040523-1|AAH40523.1| 1551|Homo sapiens CCR4-NOT transcription ... 30 4.9 BC024317-1|AAH24317.1| 1620|Homo sapiens CNOT1 protein protein. 30 4.9 AB023224-1|BAA76851.2| 1835|Homo sapiens KIAA1007 protein protein. 30 4.9 BC059402-1|AAH59402.1| 842|Homo sapiens round spermatid basic p... 29 8.6 >BX538345-1|CAD98108.1| 1582|Homo sapiens hypothetical protein protein. Length = 1582 Score = 34.3 bits (75), Expect = 0.30 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +2 Query: 92 HVLGAAPKPFDKHTFMPSALDFYQTALRDPAFYQLYNRIVGYINAFKHYLK-PYPQEKLH 268 H+ APK FD+ T + +D + D YQ Y RI+ I A + P E LH Sbjct: 1337 HLYAWAPKSFDESTAIKVCIDQSADSEGDYMSYQAYIRILAKIQAADPVNRFKRPDELLH 1396 Query: 269 FVGVKINDVVVEKLVT 316 + +K+ + K VT Sbjct: 1397 LLKLKVFPTLDHKPVT 1412 >X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila Fat protein protein. Length = 4590 Score = 32.7 bits (71), Expect = 0.93 Identities = 15/50 (30%), Positives = 30/50 (60%) Frame = -3 Query: 526 GESIIVVLRSQEDLXNGISGNIGLNVDGNTERLVVESWLTNLEVVWVTSL 377 G S ++ +R+ D +G +G + ++D + V+ES+ N+E W+T+L Sbjct: 2826 GGSRVIQIRAS-DADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTL 2874 >BX537840-1|CAD97851.1| 2150|Homo sapiens hypothetical protein protein. Length = 2150 Score = 30.3 bits (65), Expect = 4.9 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +2 Query: 80 IVARHVLGAAPKPFDK--HTFMPSALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPY 250 + R+VL A KPF + F +ALD ++ L+D Y + + + F H+L+ Y Sbjct: 928 LALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEY 986 Score = 30.3 bits (65), Expect = 4.9 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +2 Query: 146 ALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 325 AL + ALR P ++Y + ++ FK+ LK YPQ H + L + + Sbjct: 929 ALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEYIE 988 Query: 326 YSQ 334 Y Q Sbjct: 989 YGQ 991 >BC040523-1|AAH40523.1| 1551|Homo sapiens CCR4-NOT transcription complex, subunit 1 protein. Length = 1551 Score = 30.3 bits (65), Expect = 4.9 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +2 Query: 80 IVARHVLGAAPKPFDK--HTFMPSALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPY 250 + R+VL A KPF + F +ALD ++ L+D Y + + + F H+L+ Y Sbjct: 933 LALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEY 991 Score = 30.3 bits (65), Expect = 4.9 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +2 Query: 146 ALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 325 AL + ALR P ++Y + ++ FK+ LK YPQ H + L + + Sbjct: 934 ALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEYIE 993 Query: 326 YSQ 334 Y Q Sbjct: 994 YGQ 996 >BC024317-1|AAH24317.1| 1620|Homo sapiens CNOT1 protein protein. Length = 1620 Score = 30.3 bits (65), Expect = 4.9 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +2 Query: 80 IVARHVLGAAPKPFDK--HTFMPSALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPY 250 + R+VL A KPF + F +ALD ++ L+D Y + + + F H+L+ Y Sbjct: 177 LALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEY 235 Score = 30.3 bits (65), Expect = 4.9 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +2 Query: 146 ALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 325 AL + ALR P ++Y + ++ FK+ LK YPQ H + L + + Sbjct: 178 ALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEYIE 237 Query: 326 YSQ 334 Y Q Sbjct: 238 YGQ 240 >AB023224-1|BAA76851.2| 1835|Homo sapiens KIAA1007 protein protein. Length = 1835 Score = 30.3 bits (65), Expect = 4.9 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +2 Query: 80 IVARHVLGAAPKPFDK--HTFMPSALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPY 250 + R+VL A KPF + F +ALD ++ L+D Y + + + F H+L+ Y Sbjct: 392 LALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEY 450 Score = 30.3 bits (65), Expect = 4.9 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +2 Query: 146 ALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 325 AL + ALR P ++Y + ++ FK+ LK YPQ H + L + + Sbjct: 393 ALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEYIE 452 Query: 326 YSQ 334 Y Q Sbjct: 453 YGQ 455 >BC059402-1|AAH59402.1| 842|Homo sapiens round spermatid basic protein 1-like protein. Length = 842 Score = 29.5 bits (63), Expect = 8.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 308 LVTFFDYSQFDATNSVFLTKKEIKTSYPHNFKVRQPR 418 L F DY F+ NS L KK+I+T+ NF + R Sbjct: 411 LPDFLDYFSFNFPNSPVLGKKDIETTTMSNFHAQVKR 447 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,963,725 Number of Sequences: 237096 Number of extensions: 1559326 Number of successful extensions: 6555 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6555 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5759818212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -