BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N24 (386 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56655| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-12 SB_24582| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.020 SB_30473| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.0 SB_11110| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_52316| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=8) 29 1.8 SB_15331| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) 28 2.3 SB_19792| Best HMM Match : SspH (HMM E-Value=6.6) 28 2.3 SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) 27 4.0 SB_11254| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_7748| Best HMM Match : DUF229 (HMM E-Value=4.5e-10) 27 5.3 SB_2894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_38495| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_42273| Best HMM Match : 7tm_1 (HMM E-Value=5.2e-07) 26 9.3 SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_41532| Best HMM Match : Extensin_2 (HMM E-Value=1.4) 26 9.3 SB_41146| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 26 9.3 SB_15859| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_1812| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-07) 26 9.3 SB_1163| Best HMM Match : DMA (HMM E-Value=1.4e-11) 26 9.3 >SB_56655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 68.9 bits (161), Expect = 1e-12 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = +2 Query: 62 EAFFDEYDYYNFDHDKHIFTGHGGKQRTKREATEHTNHFDPSGHSRKIVTKLVNTENNK 238 E +FDEYDYYNFD +++ G+ K R+KREA +TN F P GH RK++ K NTE N+ Sbjct: 2 EPYFDEYDYYNFD--RNVVEGNTRKGRSKREACLNTNRFCPGGHERKVLEKYRNTEKNR 58 >SB_24582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 35.1 bits (77), Expect = 0.020 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +2 Query: 74 DEYDYYNFDHDKHIFTGHGGKQRTKREATEHTNHFDPSGHS-RKIVTKLVNTENNKKSNK 250 D+YD Y+FD H G K ++K+EA+++ N GHS RK + + E+ +K K Sbjct: 5 DKYDDYDFDERLH--EGGARKGKSKKEASQNKN-VSTQGHSERKAAEYIQHGEDKRKEEK 61 >SB_30473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 345 Score = 29.5 bits (63), Expect = 1.0 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 125 HGGKQRTKREATEH--TNHFDPSGHSRKIVTKLVNTENNKKSN 247 HG K++ KR EH NH D S ++K+ +K N KSN Sbjct: 191 HGAKRKRKRTKDEHKVVNHADGSDDAKKLHSK--TDTNPSKSN 231 >SB_11110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 28.7 bits (61), Expect = 1.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 50 VTMSEAFFDEYDYYNFDHDKHI 115 V+ +AF+ +DYY F HD ++ Sbjct: 508 VSEGKAFYGSFDYYQFPHDSNL 529 >SB_52316| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=8) Length = 420 Score = 28.7 bits (61), Expect = 1.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 50 VTMSEAFFDEYDYYNFDHDKHI 115 V+ +AF+ +DYY F HD ++ Sbjct: 66 VSEGKAFYGSFDYYQFPHDSNL 87 >SB_15331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 119 TGHGGKQRTKREATEHTNHFDPSGHSRKIVTKLVNTENNKKSNK 250 +G GK+ K E N +P +KI T+ V NK+ +K Sbjct: 18 SGSSGKEMRKISTEEKPNQSEPPKKVKKIKTEKVEKTTNKQQSK 61 >SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) Length = 1265 Score = 28.3 bits (60), Expect = 2.3 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +2 Query: 92 NFDHDKHIFTGHGGKQRTKREATEHTNHF-DPSGHSRKIVTKLVNTENNKKSN 247 N D + I HGG+ +T + D SGHS T +NT N+ + N Sbjct: 292 NKDITQEIMARHGGQSAGTPSSTGSPSTTPDASGHSSNSNTPPINTNNSAEQN 344 >SB_19792| Best HMM Match : SspH (HMM E-Value=6.6) Length = 244 Score = 28.3 bits (60), Expect = 2.3 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = +2 Query: 101 HDKHIFTGHGGKQRTKREATEHTNHFDP----SGHSRKIVTKLVN 223 H I+T H +T R T+H N+ + H+ +I T LVN Sbjct: 45 HAARIYTNHVNDSQTARIYTQHVNYSQTARIYTQHAARIYTNLVN 89 >SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) Length = 1291 Score = 27.5 bits (58), Expect = 4.0 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 7/64 (10%) Frame = -3 Query: 300 IFLLQAIVVFIHRYIYCLLDFLLFSVFTNFVTIF------LEC-PEGSK*FVCSVASRLV 142 I + ++FI + +L +FSV F+T+F L C P S CS +S L+ Sbjct: 1159 ITVFSVTILFITVFSVIILFITVFSVIILFITVFSIIILLLPCSPSSSFSLPCSPSSFLL 1218 Query: 141 RCLP 130 C P Sbjct: 1219 PCSP 1222 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = -3 Query: 339 IRHNVLLSLGNSVIFLL---QAIVVFIHRYIYCLLDFLLFSVFTNFVTIF 199 +RH+ +++ + +I + I++FI + +L +FSV F+T+F Sbjct: 1103 LRHHPFITVFSVIILFITVFSVIILFITVFSVIILFITVFSVIILFITVF 1152 >SB_11254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 27.1 bits (57), Expect = 5.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 80 YDYYNFDHDKHIFTGHGGKQR 142 YDY + D+D H + GKQR Sbjct: 17 YDYVDLDNDSHDYETMNGKQR 37 >SB_7748| Best HMM Match : DUF229 (HMM E-Value=4.5e-10) Length = 784 Score = 27.1 bits (57), Expect = 5.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 142 YQAGGHRTHESLRPLWTFQKDRHEVSEYGEQ 234 +QA G T E+LRPL++ + H G Q Sbjct: 244 FQAVGQHTFENLRPLFSGRTANHSADSLGIQ 274 >SB_2894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 27.1 bits (57), Expect = 5.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 80 YDYYNFDHDKHIFTGHGGKQR 142 YDY + D+D H + GKQR Sbjct: 103 YDYVDLDNDSHDYETMNGKQR 123 >SB_38495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 26.6 bits (56), Expect = 7.1 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 128 GGKQRTKREATEHTNHFDPSGHSRKIVTKLVNT 226 GGKQ EA E SG SR++V + VNT Sbjct: 29 GGKQTEIAEAREKLAILVASGKSREMVARHVNT 61 >SB_42273| Best HMM Match : 7tm_1 (HMM E-Value=5.2e-07) Length = 259 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 281 MACRRNITELPSERRTLWR 337 + CRRN LPSE R WR Sbjct: 236 LLCRRNNNILPSESRGPWR 254 >SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 26.2 bits (55), Expect = 9.3 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +3 Query: 183 PLDIPEXXXXXXXXXXTTKSPINNRCNGE*TRLWLVEGILPSCLAK 320 PL IP +T+ NNRCN E T L G P+ L + Sbjct: 151 PLAIPYSLALRIRRICSTEESFNNRCN-ELTNYLLKRGYKPAFLKR 195 >SB_41532| Best HMM Match : Extensin_2 (HMM E-Value=1.4) Length = 1633 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +2 Query: 98 DHDKHIFTGHGGKQRTKREATEHTNHFDPSGHSRKIVTKLVNTENNK 238 ++ + I GG K + + T F P+ SRK KL +++ ++ Sbjct: 1294 ENSQTITRERGGDDNCKSSSLQRTEDFSPAQFSRKSPRKLTSSKGSQ 1340 >SB_41146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 211 RDDLSGMSRGVEVIRVFGGLPLGTLFTSVSGEN 113 RDD+S +RGV + GT+ +V GE+ Sbjct: 687 RDDISSRTRGVTSHKTSTASEAGTVIVNVEGEH 719 >SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 1443 Score = 26.2 bits (55), Expect = 9.3 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +3 Query: 183 PLDIPEXXXXXXXXXXTTKSPINNRCNGE*TRLWLVEGILPSCLAK 320 PL IP +T+ NNRCN E T L G P+ L + Sbjct: 386 PLAIPYSLALRIRRICSTEESFNNRCN-ELTNYLLKRGYKPAFLKR 430 >SB_15859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 26.2 bits (55), Expect = 9.3 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 98 DHDKHIFTGHGGKQRTKREATEHTNHFDPSGH 193 DH+ H GHGG++ R+ + GH Sbjct: 916 DHEGHKGNGHGGRKGKGRKGRKDKGRMGRKGH 947 >SB_1812| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-07) Length = 259 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 281 MACRRNITELPSERRTLWR 337 + CRRN LPSE R WR Sbjct: 236 LLCRRNNNILPSESRGPWR 254 >SB_1163| Best HMM Match : DMA (HMM E-Value=1.4e-11) Length = 403 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 328 RPPFARQLGNIPSTSHSRVYSP 263 R P AR L P+ S SR+Y+P Sbjct: 309 RAPIARPLPTSPACSTSRIYTP 330 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,853,899 Number of Sequences: 59808 Number of extensions: 232338 Number of successful extensions: 662 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 669365910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -