BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N22 (505 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) 27 6.6 SB_23562| Best HMM Match : DUF288 (HMM E-Value=1.1) 27 6.6 SB_32590| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) Length = 2322 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 484 RIFHKILIYEVMYIETLISC*DIANGSLPVFSIELN 377 R+ K+++ + TLI C ANG+L +SI +N Sbjct: 899 RVSGKLIVCSISANGTLIKCSITANGTLMKYSIRVN 934 >SB_23562| Best HMM Match : DUF288 (HMM E-Value=1.1) Length = 411 Score = 27.5 bits (58), Expect = 6.6 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 15/44 (34%) Frame = +1 Query: 49 YHNLSGFIKLSVWQ*-----STP-------PWY---SPYAISNC 135 Y NL GF K +WQ STP PWY SPY + NC Sbjct: 214 YWNLVGFNKSQIWQSPNSFSSTPMYGEIEGPWYWWRSPYGLPNC 257 >SB_32590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 27.1 bits (57), Expect = 8.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 358 TAEMVFY*VRLKKRVKTHSLYLNTISAFLYTLP 456 T MV+Y V L V SLYLN + A L LP Sbjct: 220 TNAMVYYGVTLSAGVLGGSLYLNFLLASLVELP 252 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,342,241 Number of Sequences: 59808 Number of extensions: 217783 Number of successful extensions: 462 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -