BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N20 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 3.6 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 6.2 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.2 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +1 Query: 100 TKAAQYKISGESGNRQLYIIRFESQAKFEDYDDGLSG 210 T AA ++ + + GN Y++R + D D +G Sbjct: 13 TVAADFQHNWQVGNEYTYLVRSRTLTSLGDLSDVHTG 49 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 148 LYIIRFESQAKFEDYDDGLSG 210 LY+ R S+++FE Y L G Sbjct: 731 LYLHRARSESEFEMYHQQLQG 751 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 109 QLLSFWTNARGIFYSYFQHRY 47 +L+ W N+ IFY+ Q Y Sbjct: 191 KLVEKWVNSSEIFYTTSQQYY 211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,588 Number of Sequences: 438 Number of extensions: 2326 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -