BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N11 (483 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0744 - 26850761-26850771,26850794-26850861,26851464-26851861 28 3.4 02_05_0008 + 24934917-24935229,24936387-24936608,24936876-249375... 28 4.5 >11_06_0744 - 26850761-26850771,26850794-26850861,26851464-26851861 Length = 158 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 217 KHRRGEIYYNFYQQLTTRLFTSSG 288 + RRG Y+ Y ++ TRLFT SG Sbjct: 128 RRRRGRFLYSPYWKVDTRLFTFSG 151 >02_05_0008 + 24934917-24935229,24936387-24936608,24936876-24937591, 24937646-24937728,24938448-24938514,24938833-24939228, 24939276-24939318,24939380-24939474,24940287-24940314, 24940636-24940754 Length = 693 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +1 Query: 109 EQRLTYLTEDIGFNSYYYYFHSHLPFWWSSERYGNLKH 222 E+ + + IG Y Y + PF GNLKH Sbjct: 281 EESIHFFMRSIGLREYSRYLCFNFPFTHEKSLLGNLKH 318 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,615,735 Number of Sequences: 37544 Number of extensions: 249000 Number of successful extensions: 584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 987904180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -