BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N11 (483 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC030965-1|AAH30965.1| 479|Homo sapiens Rh family, C glycoprote... 30 3.7 AY257182-1|AAP81044.1| 479|Homo sapiens Rhesus-associated C gly... 30 3.7 AF284446-1|AAG02414.1| 479|Homo sapiens tumor-related protein D... 30 3.7 AF219986-1|AAG02171.1| 479|Homo sapiens Rh type C glycoprotein ... 30 3.7 AF193809-1|AAF19372.1| 479|Homo sapiens Rh type C glycoprotein ... 30 3.7 AF081497-1|AAD55748.1| 479|Homo sapiens tumor-related protein p... 30 3.7 >BC030965-1|AAH30965.1| 479|Homo sapiens Rh family, C glycoprotein protein. Length = 479 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 187 WWSSERYGNLKHRRGEIYYNF--YQQLTTRLFTSSGF 291 WWS + NL E YY + +Q + +F GF Sbjct: 40 WWSERTHKNLSDMENEFYYRYPSFQDVHVMVFVGFGF 76 >AY257182-1|AAP81044.1| 479|Homo sapiens Rhesus-associated C glycoprotein protein. Length = 479 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 187 WWSSERYGNLKHRRGEIYYNF--YQQLTTRLFTSSGF 291 WWS + NL E YY + +Q + +F GF Sbjct: 40 WWSERTHKNLSDMENEFYYRYPSFQDVHVMVFVGFGF 76 >AF284446-1|AAG02414.1| 479|Homo sapiens tumor-related protein DRC2 protein. Length = 479 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 187 WWSSERYGNLKHRRGEIYYNF--YQQLTTRLFTSSGF 291 WWS + NL E YY + +Q + +F GF Sbjct: 40 WWSERTHKNLSDMENEFYYRYPSFQDVHVMVFVGFGF 76 >AF219986-1|AAG02171.1| 479|Homo sapiens Rh type C glycoprotein protein. Length = 479 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 187 WWSSERYGNLKHRRGEIYYNF--YQQLTTRLFTSSGF 291 WWS + NL E YY + +Q + +F GF Sbjct: 40 WWSERTHKNLSDMENEFYYRYPSFQDVHVMVFVGFGF 76 >AF193809-1|AAF19372.1| 479|Homo sapiens Rh type C glycoprotein protein. Length = 479 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 187 WWSSERYGNLKHRRGEIYYNF--YQQLTTRLFTSSGF 291 WWS + NL E YY + +Q + +F GF Sbjct: 40 WWSERTHKNLSDMENEFYYRYPSFQDVHVMVFVGFGF 76 >AF081497-1|AAD55748.1| 479|Homo sapiens tumor-related protein protein. Length = 479 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 187 WWSSERYGNLKHRRGEIYYNF--YQQLTTRLFTSSGF 291 WWS + NL E YY + +Q + +F GF Sbjct: 40 WWSERTHKNLSDMENEFYYRYPSFQDVHVMVFVGFGF 76 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,346,619 Number of Sequences: 237096 Number of extensions: 1494680 Number of successful extensions: 2493 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2490 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4327667848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -