BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N11 (483 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81579-9|CAN99688.1| 225|Caenorhabditis elegans Hypothetical pr... 28 3.1 U39472-9|AAK31390.2| 327|Caenorhabditis elegans Serpentine rece... 27 9.4 >Z81579-9|CAN99688.1| 225|Caenorhabditis elegans Hypothetical protein R13H4.2a protein. Length = 225 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +1 Query: 127 LTEDIGFNSYYYYFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTR 270 L +D ++ YYY+ + ++ S RY + Y+N Y TR Sbjct: 71 LYDDYWYDKYYYFSPLYRSTYYPSRRYSYSDYLPNPYYWNNYGSYWTR 118 >U39472-9|AAK31390.2| 327|Caenorhabditis elegans Serpentine receptor, class a (alpha)protein 33 protein. Length = 327 Score = 26.6 bits (56), Expect = 9.4 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = -1 Query: 105 IIVKESVGIVGVIHILLFLFYNSII 31 ++ SV I+G+I ++LF FY++ + Sbjct: 228 VVSSISVAILGIIQLVLFCFYDTFL 252 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,217,331 Number of Sequences: 27780 Number of extensions: 235572 Number of successful extensions: 599 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 892829112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -