BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N10 (615 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizo... 29 0.40 SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||... 26 3.8 SPBC32F12.10 |||phosphoglucomutase |Schizosaccharomyces pombe|ch... 26 5.0 SPCC18B5.08c |||isoleucine-tRNA ligase|Schizosaccharomyces pombe... 25 6.6 >SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 29.5 bits (63), Expect = 0.40 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 479 ILCHLHHLCRPGCQIV 432 ILC L+H C P CQI+ Sbjct: 188 ILCRLNHSCDPNCQII 203 >SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 3971 Score = 26.2 bits (55), Expect = 3.8 Identities = 19/72 (26%), Positives = 33/72 (45%) Frame = +2 Query: 143 NVAGITSASAVLKVRSSPEITITPSNFQQVLRGDPVSVECRANGYPDPIVSIKTSVDLRE 322 N ITS SA P ++ +N ++ P + + R NG+P+P + TS+ Sbjct: 77 NTINITSVSAGTNELFLPTLSHAHANDREASLFFPYT-DIRYNGFPEPSNTDSTSILSFN 135 Query: 323 VVRPSPRIAVLS 358 +R P V++ Sbjct: 136 TIRLIPSTNVIN 147 >SPBC32F12.10 |||phosphoglucomutase |Schizosaccharomyces pombe|chr 2|||Manual Length = 554 Score = 25.8 bits (54), Expect = 5.0 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Frame = +2 Query: 353 LSIPSASE-----RDSGDYICVATSPAGTVEEQFGIRVDRGDGG 469 LS P+AS + +G I A+ AG + FGI+ + G+GG Sbjct: 90 LSTPAASHIIRKYKLTGGIILTASHNAGGPKNDFGIKYNLGNGG 133 >SPCC18B5.08c |||isoleucine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 25.4 bits (53), Expect = 6.6 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 433 FFDGASR-RSCHTDIIAAITFTG*RYAKYCYPRRRPYYFT 317 F GA R SC +DII++ T+ K +P + Y T Sbjct: 304 FMQGAKRLASCPSDIISSFTYENPLLPKQSFPFLQSNYVT 343 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,511,300 Number of Sequences: 5004 Number of extensions: 49386 Number of successful extensions: 129 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -