BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N08 (547 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 5.0 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 8.7 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 498 HPRISRFHKRPQRCYYKPR*GLISRSGQXRRVP 400 HP ++ + + Y P GL+ R GQ +P Sbjct: 370 HPPVAILERNADKDYRLPDSGLLLRRGQKIMIP 402 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.6 bits (46), Expect = 8.7 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = -2 Query: 528 GEGHRRSRHDH---PRISRFHKRPQRCYYKPR 442 G G + RH H P+ RFH++ KPR Sbjct: 212 GNGIQLHRHQHQLQPQQRRFHRQSPAHRRKPR 243 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 388,340 Number of Sequences: 2352 Number of extensions: 5632 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -