BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N07 (467 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP22H7.09c |mis15||kinetochore protein Mis15 |Schizosaccharomy... 25 5.8 >SPBP22H7.09c |mis15||kinetochore protein Mis15 |Schizosaccharomyces pombe|chr 2|||Manual Length = 409 Score = 25.0 bits (52), Expect = 5.8 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -2 Query: 412 FHELRSGPLLALQSRIPDTYFLQLEPLLMVFH 317 F+ +++ PLL ++ +P YF + + +F+ Sbjct: 183 FYGIQNDPLLCTRTHLPSKYFTSVSWMTQMFY 214 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,863,490 Number of Sequences: 5004 Number of extensions: 36184 Number of successful extensions: 84 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -