BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N07 (467 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50130.2 68418.m06208 short-chain dehydrogenase/reductase (SD... 31 0.51 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 28 2.7 At3g06490.1 68416.m00753 myb family transcription factor (MYB108... 28 3.6 At2g16485.1 68415.m01889 expressed protein ; expression supporte... 27 8.4 >At5g50130.2 68418.m06208 short-chain dehydrogenase/reductase (SDR) family protein contains INTERPRO family IPR002198 Short-chain dehydrogenase/reductase (SDR) superfamily Length = 277 Score = 30.7 bits (66), Expect = 0.51 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = -2 Query: 460 DERGGVTPNPPHPGC*FHELRSGPLLALQSRIPDTYFLQLEPLLMVFHQLQHTM 299 D VT N HPG +++G + A + D+ FL LL QLQH M Sbjct: 226 DRNANVTINAVHPGI----VKTGIIRAHKGLFTDSLFLIASKLLKSISQLQHVM 275 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 28.3 bits (60), Expect = 2.7 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 304 YAEVDEKPLTAARV-GENKYQVSWTEEPAKARS-GVHEINILDEEGWASLRRA 456 Y + +P T + G+++ + W E AKA+ G+H+ NI +E+G A + A Sbjct: 281 YVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKEEDGAADSKPA 333 >At3g06490.1 68416.m00753 myb family transcription factor (MYB108) identical to transcription factor MYB108 GI:15375290 from [Arabidopsis thaliana] Length = 323 Score = 27.9 bits (59), Expect = 3.6 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +1 Query: 244 AYITEFSLKCDNPLPENYALYAEVDEKPLTAARVGENKYQVSWTEE---PAKARSGVHEI 414 +Y + +L LP+NY Y+ + ++ LTA + N +SW E A + + I Sbjct: 245 SYYPDQNLVSSQLLPDNYFDYSGLLDEDLTAMQEQSN---LSWFENINGAASSSDSLWNI 301 Query: 415 NILDEEGW 438 DEE W Sbjct: 302 GETDEEFW 309 >At2g16485.1 68415.m01889 expressed protein ; expression supported by MPSS Length = 617 Score = 26.6 bits (56), Expect = 8.4 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +1 Query: 313 VDEKPLTAARVGENKYQVSWTEEPAKARSGVHEINILD 426 V E L+ R+ ENK +VS EEP+ V E+N +D Sbjct: 139 VAEANLSGDRLEENK-EVSMEEEPSSHELSVCEVNGVD 175 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,357,534 Number of Sequences: 28952 Number of extensions: 178427 Number of successful extensions: 364 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 791932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -