BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N04 (345 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) 124 3e-29 SB_43848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_51311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) 27 5.4 SB_47862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_45659| Best HMM Match : E_Pc_C (HMM E-Value=1.2) 27 5.4 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_30783| Best HMM Match : RasGAP (HMM E-Value=3.2e-34) 27 5.4 SB_1367| Best HMM Match : EGF_2 (HMM E-Value=5.3e-06) 27 5.4 SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.4 >SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) Length = 115 Score = 124 bits (298), Expect = 3e-29 Identities = 58/72 (80%), Positives = 66/72 (91%) Frame = +1 Query: 112 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKIRGSLARRALVELRDKGLIKQVVQH 291 LNN VLFDK TY+KLYKEVP Y+LITP+VVSERLKIRGSLARRAL+EL+ KGLIK+V +H Sbjct: 41 LNNLVLFDKATYDKLYKEVPSYRLITPSVVSERLKIRGSLARRALLELQSKGLIKEVSKH 100 Query: 292 HGQVIYTRATKG 327 H Q+IYTRATKG Sbjct: 101 HSQLIYTRATKG 112 >SB_43848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 27.9 bits (59), Expect = 2.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 223 LGSSTFQRQQRV*SACTVVLPYTVSHMWVCQTTLGCLTCHGL 98 +G S++ R + S C ++ Y SH V + GCL GL Sbjct: 175 IGLSSYHRAVFLSSGCLPIIGYPTSHRRVVFPSSGCLPIIGL 216 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 27.1 bits (57), Expect = 4.1 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -2 Query: 161 LYSFSYVGLSNNTWLFNLSRTFPF-DHFFFLALPPPDPSFFFWVFCGCLAE 12 LYS++ VG++ F L +HF+ P P+ F V+C L E Sbjct: 604 LYSYAIVGINITGMAFRLLEDGSLRNHFYNCKHDKPSPTDFHEVYCYLLYE 654 >SB_51311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 26.6 bits (56), Expect = 5.4 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -2 Query: 176 YCGTSLYSFSYVGLSNNTWLFNLSRTFPFDHFFFLA-LPPPDPSFFFWVF 30 Y TS ++F Y SN+T+ + + + F + F A +P PS F Sbjct: 57 YAFTSNHTFHYTFTSNHTFHYTFTSSHTFHYAFTKAIIPSTTPSLVIITF 106 >SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) Length = 1044 Score = 26.6 bits (56), Expect = 5.4 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 282 YLFD*TFISKFDKCSPGKGASDLQPFRDNSGCDQLVLWYFLIQFLIC 142 Y D +++ K CSPG +DL+ F C L ++ L +F +C Sbjct: 172 YKIDGSYLEKCTDCSPG---TDLKKFAGFRACPCLPGYFRLDRFGLC 215 >SB_47862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 26.6 bits (56), Expect = 5.4 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -2 Query: 158 YSFSYVGLSNNTWLFNLSRTFPFDHFFFLALPPPDPSFFFWV 33 YS S G + N F LSR DH FFL P P F WV Sbjct: 194 YSVSPYGWAYN---FMLSRA---DHMFFLFSPVPIEWFTLWV 229 >SB_45659| Best HMM Match : E_Pc_C (HMM E-Value=1.2) Length = 1244 Score = 26.6 bits (56), Expect = 5.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 167 TSLYSFSYVGLSNNTWLFNLSRTFPFDH 84 +SL+ G+SN+ WL N S T P +H Sbjct: 250 SSLHIEKENGISNDDWLSNPSFTSPIEH 277 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 26.6 bits (56), Expect = 5.4 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 249 DKCSPG-KGASDLQPFRDNSGCDQLVL 172 +KC PG +GA L R N+GC + V+ Sbjct: 1488 NKCVPGVRGAECLPGMRGNNGCPECVV 1514 >SB_30783| Best HMM Match : RasGAP (HMM E-Value=3.2e-34) Length = 912 Score = 26.6 bits (56), Expect = 5.4 Identities = 11/38 (28%), Positives = 15/38 (39%) Frame = -3 Query: 169 VLPYTVSHMWVCQTTLGCLTCHGLFLLTTSSSWLCRHR 56 +LP+ W G CH L + T W C H+ Sbjct: 524 ILPWIKLQDWEAARKTGKQVCHLLSICTLIRPWACLHQ 561 >SB_1367| Best HMM Match : EGF_2 (HMM E-Value=5.3e-06) Length = 776 Score = 26.6 bits (56), Expect = 5.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 80 FFLALPPPDPSFFFWVFCGC 21 +F+ALPP +P + FC C Sbjct: 528 YFVALPPHEPQVYKGEFCHC 547 >SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1503 Score = 25.8 bits (54), Expect = 9.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 173 CGTSLYSFSYVGLSNNTWLFNLSRTFP 93 CG + +Y GL N W+ ++R P Sbjct: 1248 CGKRTFMPNYAGLRGNLWITRITRKKP 1274 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,803,089 Number of Sequences: 59808 Number of extensions: 174827 Number of successful extensions: 449 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 510674393 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -