BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N01 (581 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.47 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 3.3 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 7.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 7.6 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 21 7.6 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.0 bits (52), Expect = 0.47 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 484 SSVPYFSAK*QAIARLSHKTNPS 552 S +PYF+A A + LS KTN S Sbjct: 284 SHLPYFAAAVAAASNLSPKTNSS 306 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 569 PTLKEDDGFVLWESRA 522 PT+KED VLW+ ++ Sbjct: 184 PTIKEDFCAVLWKDKS 199 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 7.6 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 302 FLKESKWVAGDSLTIADTSIYASVSTILAVGWDIDSFP 189 FL +++ D L+ I + ILA+ DID P Sbjct: 131 FLLGFRYLVNDELSAHSKEIRGENTYILALDGDIDFQP 168 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 7.6 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 302 FLKESKWVAGDSLTIADTSIYASVSTILAVGWDIDSFP 189 FL +++ D L+ I + ILA+ DID P Sbjct: 445 FLLGFRYLVNDELSAHSKEIRGENTYILALDGDIDFQP 482 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.0 bits (42), Expect = 7.6 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -1 Query: 251 TSIYASVSTILAVGWDIDSFPNIQRWIKECSGIPGAAEN 135 T + + S I + +D+F +I WI C+ AA++ Sbjct: 93 TILKKTKSNIFILKESVDTFNDIFGWIILCNIFEAAAKS 131 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,614 Number of Sequences: 336 Number of extensions: 3020 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -