BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_N01 (581 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 0.95 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 6.7 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 8.9 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 21 8.9 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 24.2 bits (50), Expect = 0.95 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -2 Query: 196 VSPIFKGGLKNAPEYQVLLKMMKVQNYLENLLKK 95 +SPIF G Y ++ + ++ YL+ L++K Sbjct: 135 LSPIFTSGKLKEMFYLIIECSLNLETYLDKLIEK 168 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 509 LAEKYGTDDQFYPKDLKRRALV 444 LAE+ GTD+ + K LK+ ++ Sbjct: 2 LAERKGTDELYAIKILKKDIII 23 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -3 Query: 333 PKCYPRVFGFILKRKQM 283 P C P++F F L Q+ Sbjct: 153 PMCSPKLFAFDLNTSQL 169 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 530 FPIKQIHRLPLK 565 FP K H+LPLK Sbjct: 134 FPSKMDHQLPLK 145 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,870 Number of Sequences: 438 Number of extensions: 3364 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -