BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M23 (538 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 2.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.6 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.6 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 2.8 Identities = 20/78 (25%), Positives = 32/78 (41%) Frame = -3 Query: 530 LFLNIYKVQILFHNSXXXXXKVKICVQF*INICKYIKSVTILNNEYITTPLKMCQYNLII 351 LFLN+ L H+ + + F IN K++ N ++ P + Y+L Sbjct: 2220 LFLNVLSGAALLHSEDSCIMRY-VTATF-INAASNFKNIFSTNGYFMIMPAMLQVYSLHQ 2277 Query: 350 KIKLFY*HNNYALKLIYI 297 KL YA+K Y+ Sbjct: 2278 TNKLVTTTIEYAVKQFYL 2295 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 8.6 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +2 Query: 143 LIEKYIPGVLEW*ESDEQGNNSYSILYD 226 L + Y+ + + E+D G +SY+ +Y+ Sbjct: 2145 LADNYLTESVSYLETDSYGQDSYTPIYE 2172 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 8.6 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +2 Query: 143 LIEKYIPGVLEW*ESDEQGNNSYSILYD 226 L + Y+ + + E+D G +SY+ +Y+ Sbjct: 2155 LADNYLTESVSYLETDSYGQDSYTPIYE 2182 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 497,399 Number of Sequences: 2352 Number of extensions: 9211 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -