BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M23 (538 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011521-1|AAS15657.1| 292|Drosophila melanogaster RH44796p pro... 95 7e-20 AE014296-2109|AAF49947.2| 282|Drosophila melanogaster CG6910-PA... 95 7e-20 >BT011521-1|AAS15657.1| 292|Drosophila melanogaster RH44796p protein. Length = 292 Score = 94.7 bits (225), Expect = 7e-20 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +2 Query: 5 GGDYKHLLKEGDEEIKKAVLEFNQYDLYTKSAAIPDIEALWPYYESLIEKYIPGVLEW 178 GGDYKHL D E KK VL FN+YDLYTKS +PDIEALWPYY++LI+KY+PGVLE+ Sbjct: 235 GGDYKHLEAPQDAETKKWVLIFNRYDLYTKSEVVPDIEALWPYYQTLIDKYLPGVLEF 292 >AE014296-2109|AAF49947.2| 282|Drosophila melanogaster CG6910-PA protein. Length = 282 Score = 94.7 bits (225), Expect = 7e-20 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +2 Query: 5 GGDYKHLLKEGDEEIKKAVLEFNQYDLYTKSAAIPDIEALWPYYESLIEKYIPGVLEW 178 GGDYKHL D E KK VL FN+YDLYTKS +PDIEALWPYY++LI+KY+PGVLE+ Sbjct: 225 GGDYKHLEAPQDAETKKWVLIFNRYDLYTKSEVVPDIEALWPYYQTLIDKYLPGVLEF 282 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,195,339 Number of Sequences: 53049 Number of extensions: 362318 Number of successful extensions: 618 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2032955904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -