BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M21 (551 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 44 1e-06 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 27 0.13 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 4.8 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 6.3 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 6.3 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 8.3 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 43.6 bits (98), Expect = 1e-06 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = +3 Query: 120 LCAGGEAGKDSCKGDSGGPLMYEVGNT--FEAIGVVSFGTDKCGSVNIPGVYTNIYEYIP 293 +CA + GKD+C+ DSGGP++++ T IG++S+G + CG P T + YI Sbjct: 335 MCAYAK-GKDACQMDSGGPVLWQNPRTKRLVNIGIISWGAE-CG--KYPNGNTKVGSYID 390 Query: 294 WIRS 305 WI S Sbjct: 391 WIVS 394 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 27.1 bits (57), Expect = 0.13 Identities = 11/21 (52%), Positives = 18/21 (85%) Frame = -2 Query: 442 YDIRKVLRHKYLIAQYALCKL 380 Y+I+K+LR+K LI+Q A+ +L Sbjct: 474 YEIKKLLRYKLLISQNAVSEL 494 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 4.8 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -3 Query: 270 YIRRGCLLSRIYPFQ 226 Y+R GCL +R++ +Q Sbjct: 272 YLRFGCLSTRLFYYQ 286 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/30 (23%), Positives = 17/30 (56%) Frame = -3 Query: 102 QPLHLHAMSSALLDSSLYQSMEL*RVVSLY 13 QP+H+H ++ + Y+ ++ + V +Y Sbjct: 274 QPVHVHKQTAIAFRTPTYRMQQVEQPVQVY 303 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/30 (23%), Positives = 17/30 (56%) Frame = -3 Query: 102 QPLHLHAMSSALLDSSLYQSMEL*RVVSLY 13 QP+H+H ++ + Y+ ++ + V +Y Sbjct: 274 QPVHVHKQTAIAFRTPTYRMQQVEQPVQVY 303 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 8.3 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = -1 Query: 167 GVTFARVLASFTSRAQLPVIYNNLCTFTQCPLRCLTVLSTKVWN 36 G FAR+L+ T L + +C + + L V ++W+ Sbjct: 521 GTVFARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWD 564 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,648 Number of Sequences: 438 Number of extensions: 3203 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -