BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M20 (540 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00050.1 68417.m00005 basic helix-loop-helix (bHLH) family pr... 52 2e-07 At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family pr... 52 3e-07 At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family pr... 52 3e-07 At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4)... 50 1e-06 At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4)... 50 1e-06 At1g09530.2 68414.m01069 phytochrome interacting factor 3 (PIF3)... 48 5e-06 At1g09530.1 68414.m01068 phytochrome interacting factor 3 (PIF3)... 48 5e-06 At1g69010.1 68414.m07896 basic helix-loop-helix (bHLH) family pr... 46 1e-05 At2g46970.1 68415.m05867 basic helix-loop-helix (bHLH) protein, ... 46 2e-05 At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family pr... 46 2e-05 At2g20180.1 68415.m02359 basic helix-loop-helix (bHLH) family pr... 46 2e-05 At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family pr... 43 1e-04 At1g26260.2 68414.m03204 basic helix-loop-helix (bHLH) family pr... 43 1e-04 At1g26260.1 68414.m03203 basic helix-loop-helix (bHLH) family pr... 43 1e-04 At3g23690.1 68416.m02979 basic helix-loop-helix (bHLH) family pr... 42 2e-04 At2g18300.2 68415.m02134 basic helix-loop-helix (bHLH) family pr... 42 2e-04 At2g18300.1 68415.m02133 basic helix-loop-helix (bHLH) family pr... 42 2e-04 At4g36930.1 68417.m05235 basic helix-loop-helix (bHLH) protein S... 41 5e-04 At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family pr... 41 6e-04 At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family pr... 40 8e-04 At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family pr... 39 0.002 At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family pr... 39 0.002 At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family pr... 39 0.002 At5g38860.1 68418.m04700 basic helix-loop-helix (bHLH) family pr... 39 0.002 At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family pr... 39 0.002 At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family pr... 39 0.002 At4g28800.1 68417.m04118 bHLH family protein contains Pfam profi... 39 0.002 At4g27120.2 68417.m03898 expressed protein 39 0.002 At4g27120.1 68417.m03897 expressed protein 39 0.002 At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family pr... 38 0.003 At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family pr... 38 0.003 At5g08130.1 68418.m00948 basic helix-loop-helix (bHLH) family pr... 38 0.004 At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family pr... 38 0.004 At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family pr... 38 0.006 At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family pr... 38 0.006 At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family pr... 38 0.006 At1g02340.1 68414.m00180 long hypocotyl in far-red 1 (HFR1) / re... 37 0.007 At5g67110.1 68418.m08461 basic helix-loop-helix (bHLH) family pr... 37 0.010 At3g07340.1 68416.m00875 basic helix-loop-helix (bHLH) family pr... 37 0.010 At2g22750.1 68415.m02697 basic helix-loop-helix (bHLH) family pr... 37 0.010 At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family pr... 36 0.013 At1g59640.2 68414.m06708 basic helix-loop-helix (bHLH) family pr... 36 0.023 At1g59640.1 68414.m06707 basic helix-loop-helix (bHLH) family pr... 36 0.023 At3g57800.2 68416.m06443 basic helix-loop-helix (bHLH) family pr... 35 0.030 At5g62610.1 68418.m07857 basic helix-loop-helix (bHLH) family pr... 35 0.040 At3g57800.1 68416.m06442 basic helix-loop-helix (bHLH) family pr... 34 0.053 At2g42300.1 68415.m05236 basic helix-loop-helix (bHLH) family pr... 34 0.053 At5g50915.2 68418.m06314 basic helix-loop-helix (bHLH) family pr... 34 0.070 At5g50915.1 68418.m06313 basic helix-loop-helix (bHLH) family pr... 34 0.070 At4g01720.1 68417.m00223 WRKY family transcription factor simila... 34 0.070 At5g48560.1 68418.m06005 basic helix-loop-helix (bHLH) family pr... 33 0.12 At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763... 33 0.16 At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family pr... 31 0.37 At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family pr... 31 0.37 At1g50410.1 68414.m05650 SNF2 domain-containing protein / helica... 31 0.37 At1g25330.1 68414.m03143 basic helix-loop-helix (bHLH) family pr... 31 0.37 At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family pr... 31 0.37 At3g28770.1 68416.m03591 expressed protein 31 0.49 At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family pr... 31 0.49 At1g25310.1 68414.m03141 basic helix-loop-helix (bHLH) family pr... 31 0.49 At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putati... 31 0.49 At5g46760.1 68418.m05760 basic helix-loop-helix (bHLH) family pr... 30 0.86 At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family pr... 30 0.86 At4g00870.1 68417.m00118 basic helix-loop-helix (bHLH) family pr... 30 0.86 At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to... 30 0.86 At2g44200.1 68415.m05500 expressed protein 30 0.86 At2g40200.1 68415.m04943 basic helix-loop-helix (bHLH) family pr... 30 0.86 At1g63650.2 68414.m07202 basic helix-loop-helix (bHLH) family pr... 30 0.86 At1g63650.1 68414.m07201 basic helix-loop-helix (bHLH) family pr... 30 0.86 At1g61660.2 68414.m06950 basic helix-loop-helix (bHLH) family pr... 30 0.86 At1g61660.1 68414.m06949 basic helix-loop-helix (bHLH) family pr... 30 0.86 At5g37800.1 68418.m04552 basic helix-loop-helix (bHLH) family pr... 30 1.1 At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family pr... 30 1.1 At2g14760.1 68415.m01667 basic helix-loop-helix protein / bHLH p... 30 1.1 At3g29075.1 68416.m03637 glycine-rich protein 29 1.5 At5g63720.1 68418.m07998 hypothetical protein 29 2.0 At5g43650.1 68418.m05335 basic helix-loop-helix (bHLH) family pr... 29 2.0 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 29 2.0 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 29 2.0 At2g45130.1 68415.m05616 SPX (SYG1/Pho81/XPR1) domain-containing... 29 2.0 At1g68810.1 68414.m07866 basic helix-loop-helix (bHLH) family pr... 29 2.0 At4g16430.1 68417.m02487 basic helix-loop-helix (bHLH) family pr... 29 2.6 At3g30725.1 68416.m03909 expressed protein ; expression supporte... 29 2.6 At2g20310.1 68415.m02372 expressed protein 29 2.6 At2g06210.2 68415.m00683 phosphoprotein-related low similarity t... 29 2.6 At2g06210.1 68415.m00684 phosphoprotein-related low similarity t... 29 2.6 At1g66470.1 68414.m07551 basic helix-loop-helix (bHLH) family pr... 29 2.6 At4g29930.1 68417.m04258 basic helix-loop-helix (bHLH) family pr... 28 3.5 At3g30775.1 68416.m03933 proline oxidase, mitochondrial / osmoti... 28 3.5 At3g20640.1 68416.m02612 ethylene-responsive protein -related co... 28 3.5 At2g22770.1 68415.m02701 basic helix-loop-helix (bHLH) family pr... 28 3.5 At2g02480.1 68415.m00187 DNA polymerase-related weak similarity ... 28 3.5 At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein (... 28 3.5 At5g16500.1 68418.m01928 protein kinase family protein contains ... 28 4.6 At3g25710.1 68416.m03199 basic helix-loop-helix (bHLH) family pr... 28 4.6 At3g21480.1 68416.m02710 transcription activation domain-interac... 28 4.6 At1g17820.1 68414.m02206 expressed protein 28 4.6 At5g41090.1 68418.m04995 no apical meristem (NAM) family protein... 27 6.1 At4g09820.1 68417.m01611 basic helix-loop-helix (bHLH) family pr... 27 6.1 At4g04890.1 68417.m00712 homeobox-leucine zipper protein protode... 27 6.1 At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family... 27 6.1 At2g03810.2 68415.m00341 18S pre-ribosomal assembly protein gar2... 27 6.1 At2g03810.1 68415.m00340 18S pre-ribosomal assembly protein gar2... 27 6.1 At1g77500.1 68414.m09025 expressed protein contains Pfam domains... 27 6.1 At1g57680.2 68414.m06546 expressed protein 27 6.1 At1g57680.1 68414.m06545 expressed protein 27 6.1 At1g52160.1 68414.m05887 metallo-beta-lactamase family protein 27 6.1 At1g14687.1 68414.m01755 zinc finger homeobox family protein / Z... 27 6.1 At1g10610.1 68414.m01202 basic helix-loop-helix (bHLH) family pr... 27 6.1 At5g56960.1 68418.m07110 basic helix-loop-helix (bHLH) family pr... 27 8.0 At4g33880.1 68417.m04807 basic helix-loop-helix (bHLH) family pr... 27 8.0 At4g29550.1 68417.m04214 expressed protein contains Pfam profile... 27 8.0 At4g27290.1 68417.m03916 S-locus protein kinase, putative simila... 27 8.0 At3g29763.1 68416.m03760 hypothetical protein 27 8.0 At2g28160.1 68415.m03420 basic helix-loop-helix (bHLH) family pr... 27 8.0 At2g16910.1 68415.m01948 basic helix-loop-helix (bHLH) family pr... 27 8.0 At1g29570.1 68414.m03616 zinc finger protein-related contains si... 27 8.0 At1g19260.1 68414.m02396 hAT dimerisation domain-containing prot... 27 8.0 >At4g00050.1 68417.m00005 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 399 Score = 52.0 bits (119), Expect = 2e-07 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 1/96 (1%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA-HTQAEQKRRDAIKKGY 371 GS + + H + S EDE++ S++S K R A H Q+E+KRRD I + Sbjct: 174 GSHDNTIDDHDSVCHSRPQMEDEEEKKAGGKSSVSTKRSRAAAIHNQSERKRRDKINQRM 233 Query: 372 DSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 +LQ+LVP +TD KA++L + I+Y++ L Sbjct: 234 KTLQKLVPNSSKTD-------KASMLDEVIEYLKQL 262 >At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 444 Score = 51.6 bits (118), Expect = 3e-07 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 3/79 (3%) Frame = +3 Query: 252 TEDEDDSGDNKASALSFKERRR---EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 422 T +D + NK+S S RR E H +E++RRD I + +LQEL+P C +TD Sbjct: 234 TSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD--- 290 Query: 423 YKHSKAAVLQKSIDYIQYL 479 KA++L ++IDY++ L Sbjct: 291 ----KASILDEAIDYLKSL 305 >At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 442 Score = 51.6 bits (118), Expect = 3e-07 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 3/79 (3%) Frame = +3 Query: 252 TEDEDDSGDNKASALSFKERRR---EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 422 T +D + NK+S S RR E H +E++RRD I + +LQEL+P C +TD Sbjct: 234 TSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD--- 290 Query: 423 YKHSKAAVLQKSIDYIQYL 479 KA++L ++IDY++ L Sbjct: 291 ----KASILDEAIDYLKSL 305 >At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 428 Score = 49.6 bits (113), Expect = 1e-06 Identities = 25/67 (37%), Positives = 41/67 (61%) Frame = +3 Query: 279 NKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKS 458 N+ S + + R E H +E++RRD I + +LQEL+P C +TD KA++L ++ Sbjct: 247 NQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTD-------KASILDEA 299 Query: 459 IDYIQYL 479 IDY++ L Sbjct: 300 IDYLKSL 306 >At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 430 Score = 49.6 bits (113), Expect = 1e-06 Identities = 25/67 (37%), Positives = 41/67 (61%) Frame = +3 Query: 279 NKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKS 458 N+ S + + R E H +E++RRD I + +LQEL+P C +TD KA++L ++ Sbjct: 247 NQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTD-------KASILDEA 299 Query: 459 IDYIQYL 479 IDY++ L Sbjct: 300 IDYLKSL 306 >At1g09530.2 68414.m01069 phytochrome interacting factor 3 (PIF3) identical to phytochrome interacting factor 3 (PIF3) GI:3929585 from [Arabidopsis thaliana] Length = 524 Score = 47.6 bits (108), Expect = 5e-06 Identities = 31/99 (31%), Positives = 54/99 (54%), Gaps = 8/99 (8%) Frame = +3 Query: 207 SIQNIHQTPSSSNQNTED-EDDSGDNKASAL-------SFKERRREAHTQAEQKRRDAIK 362 S++ H + ++ED E++SGD + A S + R E H +E++RRD I Sbjct: 301 SLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRIN 360 Query: 363 KGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 + +LQEL+P C + D KA++L ++I+Y++ L Sbjct: 361 EKMRALQELIPNCNKVD-------KASMLDEAIEYLKSL 392 >At1g09530.1 68414.m01068 phytochrome interacting factor 3 (PIF3) identical to phytochrome interacting factor 3 (PIF3) GI:3929585 from [Arabidopsis thaliana] Length = 524 Score = 47.6 bits (108), Expect = 5e-06 Identities = 31/99 (31%), Positives = 54/99 (54%), Gaps = 8/99 (8%) Frame = +3 Query: 207 SIQNIHQTPSSSNQNTED-EDDSGDNKASAL-------SFKERRREAHTQAEQKRRDAIK 362 S++ H + ++ED E++SGD + A S + R E H +E++RRD I Sbjct: 301 SLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRIN 360 Query: 363 KGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 + +LQEL+P C + D KA++L ++I+Y++ L Sbjct: 361 EKMRALQELIPNCNKVD-------KASMLDEAIEYLKSL 392 >At1g69010.1 68414.m07896 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 311 Score = 46.4 bits (105), Expect = 1e-05 Identities = 29/83 (34%), Positives = 44/83 (53%) Frame = +3 Query: 231 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 410 PSS+ + D ++KASA+ R H+ EQ+RR I + + L+EL+P +Q Sbjct: 25 PSSNTTVHSNRDSKENDKASAI------RSKHSVTEQRRRSKINERFQILRELIPNSEQ- 77 Query: 411 DASGYKHSKAAVLQKSIDYIQYL 479 K A+ L + IDY+QYL Sbjct: 78 -----KRDTASFLLEVIDYVQYL 95 >At2g46970.1 68415.m05867 basic helix-loop-helix (bHLH) protein, putative similar to PIF3 like basic Helix Loop Helix protein (PIL1) [Arabidopsis thaliana] GI:22535492; contains Myc-type, 'helix-loop-helix' dimerization domain signature, PROSITE:PS00038 Length = 416 Score = 46.0 bits (104), Expect = 2e-05 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 3/95 (3%) Frame = +3 Query: 204 GSIQNIHQTPSSSNQNTEDEDDSGDNKASA---LSFKERRREAHTQAEQKRRDAIKKGYD 374 G I+ T S+N + E +D A ++ ++R E H E+KRRD K Sbjct: 191 GDIEEEESTYLSNNSDDESDDAKTQVHARTRKPVTKRKRSTEVHKLYERKRRDEFNKKMR 250 Query: 375 SLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 +LQ+L+P C YK KA++L ++I Y++ L Sbjct: 251 ALQDLLPNC-------YKDDKASLLDEAIKYMRTL 278 >At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 478 Score = 45.6 bits (103), Expect = 2e-05 Identities = 25/83 (30%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +3 Query: 234 SSSNQNTEDEDDSGDNKASALSFKERRR-EAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 410 +++++ +++ + S S K R E H +E+KRRD I + +LQEL+P C ++ Sbjct: 258 TTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKS 317 Query: 411 DASGYKHSKAAVLQKSIDYIQYL 479 D KA++L ++I+Y++ L Sbjct: 318 D-------KASMLDEAIEYMKSL 333 >At2g20180.1 68415.m02359 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 407 Score = 45.6 bits (103), Expect = 2e-05 Identities = 25/83 (30%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +3 Query: 234 SSSNQNTEDEDDSGDNKASALSFKERRR-EAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 410 +++++ +++ + S S K R E H +E+KRRD I + +LQEL+P C ++ Sbjct: 187 TTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKS 246 Query: 411 DASGYKHSKAAVLQKSIDYIQYL 479 D KA++L ++I+Y++ L Sbjct: 247 D-------KASMLDEAIEYMKSL 262 >At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 310 Score = 43.2 bits (97), Expect = 1e-04 Identities = 29/95 (30%), Positives = 49/95 (51%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 374 GS G Q Q+ ++++ T K + + + + H+ AE+ RR+ I + Sbjct: 100 GSGGQTQT--QSQATASATTGGATAQPQTKPKVRARRGQATDPHSIAERLRRERIAERMK 157 Query: 375 SLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 SLQELVP +TD KA++L + IDY+++L Sbjct: 158 SLQELVPNGNKTD-------KASMLDEIIDYVKFL 185 >At1g26260.2 68414.m03204 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GBOF-1 GI:5923912 from [Tulipa gesneriana] Length = 390 Score = 43.2 bits (97), Expect = 1e-04 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Frame = +3 Query: 213 QNIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSL 380 Q Q+P+S+ T E D+ K + + RR +A H+ AE+ RR+ I + L Sbjct: 193 QKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFL 252 Query: 381 QELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 Q+LVP C + KA +L + I+Y+Q L Sbjct: 253 QDLVPGCDKVT------GKAVMLDEIINYVQSL 279 >At1g26260.1 68414.m03203 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GBOF-1 GI:5923912 from [Tulipa gesneriana] Length = 390 Score = 43.2 bits (97), Expect = 1e-04 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Frame = +3 Query: 213 QNIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSL 380 Q Q+P+S+ T E D+ K + + RR +A H+ AE+ RR+ I + L Sbjct: 193 QKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFL 252 Query: 381 QELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 Q+LVP C + KA +L + I+Y+Q L Sbjct: 253 QDLVPGCDKVT------GKAVMLDEIINYVQSL 279 >At3g23690.1 68416.m02979 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 371 Score = 42.3 bits (95), Expect = 2e-04 Identities = 34/107 (31%), Positives = 49/107 (45%), Gaps = 12/107 (11%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASA---------LSFKERRREA---HTQAE 338 GS G ++ SS E D GDNK A + + RR +A H+ AE Sbjct: 147 GSKGGKRSKQDVAGSSKNGVEKCDSKGDNKDDAKPPEAPKDYIHVRARRGQATDSHSLAE 206 Query: 339 QKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 + RR+ I + LQ+LVP C + KA +L + I+Y+Q L Sbjct: 207 RARREKISERMTLLQDLVPGCNRIT------GKAVMLDEIINYVQSL 247 >At2g18300.2 68415.m02134 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;supported by cDNA gi|20127067|gb|AF488597.1| Length = 337 Score = 42.3 bits (95), Expect = 2e-04 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 4/92 (4%) Frame = +3 Query: 216 NIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQ 383 N+ T +SS+ + E + +N K + + RR +A H+ AE+ RR+ I K LQ Sbjct: 156 NMGNTEASSDTSKETSKGASENQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQ 215 Query: 384 ELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 ++VP C + KA +L + I+Y+Q L Sbjct: 216 DIVPGCNKVT------GKAGMLDEIINYVQCL 241 >At2g18300.1 68415.m02133 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;supported by cDNA gi|20127067|gb|AF488597.1| Length = 335 Score = 42.3 bits (95), Expect = 2e-04 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 4/92 (4%) Frame = +3 Query: 216 NIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQ 383 N+ T +SS+ + E + +N K + + RR +A H+ AE+ RR+ I K LQ Sbjct: 156 NMGNTEASSDTSKETSKGASENQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQ 215 Query: 384 ELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 ++VP C + KA +L + I+Y+Q L Sbjct: 216 DIVPGCNKVT------GKAGMLDEIINYVQCL 241 >At4g36930.1 68417.m05235 basic helix-loop-helix (bHLH) protein SPATULA (SPT) identical to SPATULA (SPT) GI:11245493 from [Arabidopsis thaliana] Length = 373 Score = 41.1 bits (92), Expect = 5e-04 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 3/101 (2%) Frame = +3 Query: 186 SRCGSSGSIQNIHQTPSSSN-QNTEDEDDSGDNKASALSFKERRR--EAHTQAEQKRRDA 356 S G+SG+ + + S + DE S + S+ S +R R E H +E++RR Sbjct: 153 SSVGASGNETDEYDCESEEGGEAVVDEAPSSKSGPSSRSSSKRCRAAEVHNLSEKRRRSR 212 Query: 357 IKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 I + +LQ L+P +TD KA++L ++I+Y++ L Sbjct: 213 INEKMKALQSLIPNSNKTD-------KASMLDEAIEYLKQL 246 >At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 350 Score = 40.7 bits (91), Expect = 6e-04 Identities = 33/103 (32%), Positives = 51/103 (49%), Gaps = 8/103 (7%) Frame = +3 Query: 195 GSSGSIQNIH-QTPSSSNQNTEDEDDSGDNKA----SALSFKERRREA---HTQAEQKRR 350 GS G + N QT + + +G A S + RR +A H+ AE+ RR Sbjct: 98 GSGGGLMNQQGQTQTQTQPQASASTATGGTVAAPPQSRTKIRARRGQATDPHSIAERLRR 157 Query: 351 DAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 + I + +LQELVP +TD KA++L + IDY+++L Sbjct: 158 ERIAERMKALQELVPNGNKTD-------KASMLDEIIDYVKFL 193 >At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family protein component of the pyruvate dehydrogenase complex E3, contains PF|00010 helix-loop-helix DNA-binding domain. ESTs gb|T45640 and gb|T22783 come from this gene Length = 302 Score = 40.3 bits (90), Expect = 8e-04 Identities = 21/54 (38%), Positives = 35/54 (64%) Frame = +3 Query: 318 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 + H+ AE+ RR+ I + SLQELVPT +TD +AA++ + +DY+++L Sbjct: 153 DPHSIAERLRRERIAERIRSLQELVPTVNKTD-------RAAMIDEIVDYVKFL 199 >At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 340 Score = 39.1 bits (87), Expect = 0.002 Identities = 23/59 (38%), Positives = 32/59 (54%) Frame = +3 Query: 243 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDAS 419 NQ TE+ DS +K S R H +E++RR I + +LQEL+P C +TD S Sbjct: 261 NQGTEEARDSTSSKRS------RAAIMHKLSERRRRQKINEMMKALQELLPRCTKTDRS 313 >At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 413 Score = 39.1 bits (87), Expect = 0.002 Identities = 23/59 (38%), Positives = 32/59 (54%) Frame = +3 Query: 243 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDAS 419 NQ TE+ DS +K S R H +E++RR I + +LQEL+P C +TD S Sbjct: 261 NQGTEEARDSTSSKRS------RAAIMHKLSERRRRQKINEMMKALQELLPRCTKTDRS 313 >At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family protein similar to A. thaliana putative protein F6I18.110, GenBank accession number 2980768 Length = 310 Score = 39.1 bits (87), Expect = 0.002 Identities = 20/54 (37%), Positives = 35/54 (64%) Frame = +3 Query: 318 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 + H+ AE+ RR+ I + +LQELVPT +TD +AA++ + +DY+++L Sbjct: 155 DPHSIAERLRRERIAERIRALQELVPTVNKTD-------RAAMIDEIVDYVKFL 201 >At5g38860.1 68418.m04700 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 298 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/55 (34%), Positives = 32/55 (58%) Frame = +3 Query: 315 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 R H++ EQ+RR I + + SL +++P Q + K KA+ L + I+YI +L Sbjct: 35 RSKHSETEQRRRSKINERFQSLMDIIPQNQ----NDQKRDKASFLLEVIEYIHFL 85 >At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 302 Score = 38.7 bits (86), Expect = 0.002 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 3/84 (3%) Frame = +3 Query: 237 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 407 S+ NTE + K + + RR EA H+ AE+ RR+ I K LQ++VP C + Sbjct: 122 SNMSNTETSSEI--QKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNK 179 Query: 408 TDASGYKHSKAAVLQKSIDYIQYL 479 KA +L + I+Y+Q L Sbjct: 180 VT------GKAGMLDEIINYVQSL 197 >At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 304 Score = 38.7 bits (86), Expect = 0.002 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 3/84 (3%) Frame = +3 Query: 237 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 407 S+ NTE + K + + RR EA H+ AE+ RR+ I K LQ++VP C + Sbjct: 122 SNMSNTETSSEI--QKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNK 179 Query: 408 TDASGYKHSKAAVLQKSIDYIQYL 479 KA +L + I+Y+Q L Sbjct: 180 VT------GKAGMLDEIINYVQSL 197 >At4g28800.1 68417.m04118 bHLH family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 478 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 2/64 (3%) Frame = +3 Query: 231 PSSSNQNTEDEDDSGDNKASALSFKERRR--EAHTQAEQKRRDAIKKGYDSLQELVPTCQ 404 P++ ++ E+ G +A + ++R R E H AE++RR+ I + +LQ+L+P C Sbjct: 227 PATESKLKAREETHGTEEARGSTSRKRSRTAEMHNLAERRRREKINEKMKTLQQLIPRCN 286 Query: 405 QTDA 416 + ++ Sbjct: 287 KVES 290 >At4g27120.2 68417.m03898 expressed protein Length = 298 Score = 38.7 bits (86), Expect = 0.002 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERR---REAHTQAEQKRRDAIKK 365 G+S S N+ + S S EDED++G +A A KE++ REA QAE+ R++ Sbjct: 64 GASSSTSNVQENGSGSED--EDEDEAGGTQARASKKKEKKRQEREAQRQAEEATRESRNT 121 Query: 366 GYDSLQEL 389 D E+ Sbjct: 122 KQDWYAEM 129 >At4g27120.1 68417.m03897 expressed protein Length = 298 Score = 38.7 bits (86), Expect = 0.002 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERR---REAHTQAEQKRRDAIKK 365 G+S S N+ + S S EDED++G +A A KE++ REA QAE+ R++ Sbjct: 64 GASSSTSNVQENGSGSED--EDEDEAGGTQARASKKKEKKRQEREAQRQAEEATRESRNT 121 Query: 366 GYDSLQEL 389 D E+ Sbjct: 122 KQDWYAEM 129 >At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 366 Score = 38.3 bits (85), Expect = 0.003 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = +3 Query: 237 SSNQNTEDEDDSGDNKASALSFKERRREA-HTQAEQKRRDAIKKGYDSLQELVPTCQQTD 413 S Q+TE ++ +A + + R A H ++E++RRD I + +LQ+L+PT + D Sbjct: 141 SETQDTEGDEQETRGEAGRSNGRRGRAAAIHNESERRRRDRINQRMRTLQKLLPTASKAD 200 Query: 414 ASGYKHSKAAVLQKSIDYIQYL 479 K ++L I++++ L Sbjct: 201 -------KVSILDDVIEHLKQL 215 >At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family protein bHLH transcription factor GBOF-1, Tulipa gesneriana, EMBL:AF185269; contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain Length = 297 Score = 38.3 bits (85), Expect = 0.003 Identities = 21/54 (38%), Positives = 34/54 (62%) Frame = +3 Query: 318 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 + H+ AE+ RR+ I + SLQELVP +TD KA++L + I+Y+++L Sbjct: 108 DPHSIAERLRRERIAERMKSLQELVPNTNKTD-------KASMLDEIIEYVRFL 154 >At5g08130.1 68418.m00948 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 409 Score = 37.9 bits (84), Expect = 0.004 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +3 Query: 315 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 R H+ EQ+RR I + L++L+P Q K KA+ L + I+YIQ+L Sbjct: 158 RSKHSATEQRRRSKINDRFQMLRQLIPNSDQ------KRDKASFLLEVIEYIQFL 206 >At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 301 Score = 37.9 bits (84), Expect = 0.004 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 3/98 (3%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKK 365 G+ S + S N E K + + + RR +A H+ AE+ RR+ I + Sbjct: 106 GNDQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISE 165 Query: 366 GYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 LQELVP C + KA +L + I+Y+Q L Sbjct: 166 RMRLLQELVPGCNKIT------GKAVMLDEIINYVQSL 197 >At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 328 Score = 37.5 bits (83), Expect = 0.006 Identities = 22/79 (27%), Positives = 43/79 (54%) Frame = +3 Query: 243 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 422 +Q +++ + G +A S + + H AE+KRR+ + + + +L LVP ++ D Sbjct: 126 HQKSDEFNRKGTKRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMD--- 182 Query: 423 YKHSKAAVLQKSIDYIQYL 479 KA+VL ++ +I+YL Sbjct: 183 ----KASVLGDALKHIKYL 197 >At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 485 Score = 37.5 bits (83), Expect = 0.006 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 8/97 (8%) Frame = +3 Query: 213 QNIHQTPSS----SNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKG 368 +N Q+P+S SN + S D K + + RR +A H+ AE+ RR+ I + Sbjct: 268 RNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISER 327 Query: 369 YDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 LQ+LVP C + KA +L + I+Y+Q L Sbjct: 328 MKFLQDLVPGCNKVT------GKAVMLDEIINYVQSL 358 >At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 486 Score = 37.5 bits (83), Expect = 0.006 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 8/97 (8%) Frame = +3 Query: 213 QNIHQTPSS----SNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKG 368 +N Q+P+S SN + S D K + + RR +A H+ AE+ RR+ I + Sbjct: 269 RNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISER 328 Query: 369 YDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 LQ+LVP C + KA +L + I+Y+Q L Sbjct: 329 MKFLQDLVPGCNKVT------GKAVMLDEIINYVQSL 359 >At1g02340.1 68414.m00180 long hypocotyl in far-red 1 (HFR1) / reduced phytochrome signaling (REP1) / basic helix-loop-helix FBI1 protein (FBI1) / reduced sensitivity to far-red light (RSF1) / bHLH protein 26 (BHLH026) (BHLH26) identical to SP|Q9FE22 Long hypocotyl in far-red 1 (bHLH-like protein HFR1) (Reduced phytochrome signaling) (Basic helix-loop-helix FBI1 protein) (Reduced sensitivity to far-red light) [Arabidopsis thaliana] Length = 292 Score = 37.1 bits (82), Expect = 0.007 Identities = 23/90 (25%), Positives = 42/90 (46%) Frame = +3 Query: 210 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQEL 389 ++N H+ P DD + + R+ + ++K + ++K LQ+L Sbjct: 105 LRNKHENPKKRRIQVLSSDDESEEFTREVPSVTRKGSKRRRRDEKMSNKMRK----LQQL 160 Query: 390 VPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 VP C +TD K +VL K+I+Y++ L Sbjct: 161 VPNCHKTD-------KVSVLDKTIEYMKNL 183 >At5g67110.1 68418.m08461 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 210 Score = 36.7 bits (81), Expect = 0.010 Identities = 25/96 (26%), Positives = 51/96 (53%), Gaps = 2/96 (2%) Frame = +3 Query: 198 SSGSIQNIHQTPSSSNQNTE--DEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGY 371 S G++ ++ S + Q+ + SG + ++L + + H +E+KRR I + Sbjct: 55 SGGAVSSVGYGVSETGQDKYAFEHKRSGAKQRNSLK-RNIDAQFHNLSEKKRRSKINEKM 113 Query: 372 DSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 +LQ+L+P +TD KA++L ++I+Y++ L Sbjct: 114 KALQKLIPNSNKTD-------KASMLDEAIEYLKQL 142 >At3g07340.1 68416.m00875 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 456 Score = 36.7 bits (81), Expect = 0.010 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 9/100 (9%) Frame = +3 Query: 207 SIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKE------RRREA---HTQAEQKRRDAI 359 S + I + S + + +++GD S +K+ RR +A H+ AE+ RR+ I Sbjct: 221 SSKEIEEKEDSDPKRCKKSEENGDKTKSIDPYKDYIHVRARRGQATDSHSLAERVRREKI 280 Query: 360 KKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 + LQ+LVP C + KA +L + I+Y+Q L Sbjct: 281 SERMKLLQDLVPGCNKVT------GKALMLDEIINYVQSL 314 >At2g22750.1 68415.m02697 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 304 Score = 36.7 bits (81), Expect = 0.010 Identities = 21/69 (30%), Positives = 39/69 (56%) Frame = +3 Query: 273 GDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQ 452 G +A +L+ + + H AE+KRR+ + + + +L L+P ++ D KA+VL Sbjct: 110 GTKRAQSLTRSQSNAQDHILAERKRREKLTQRFVALSALIPGLKKMD-------KASVLG 162 Query: 453 KSIDYIQYL 479 +I +I+YL Sbjct: 163 DAIKHIKYL 171 >At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 335 Score = 36.3 bits (80), Expect = 0.013 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 6/101 (5%) Frame = +3 Query: 195 GSSGSIQNI-HQTPSSSNQNTEDEDDSGDN--KASALSFKERRREA---HTQAEQKRRDA 356 GS+ SI+ + H+ N + D K + + RR +A H+ AE+ RR+ Sbjct: 134 GSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRREK 193 Query: 357 IKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 I + LQ+LVP C + KA +L + I+Y+Q L Sbjct: 194 ISERMKFLQDLVPGCDKIT------GKAGMLDEIINYVQSL 228 >At1g59640.2 68414.m06708 basic helix-loop-helix (bHLH) family protein Length = 343 Score = 35.5 bits (78), Expect = 0.023 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 3/84 (3%) Frame = +3 Query: 237 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 407 S TE + + + + RR +A H+ AE+ RR+ I + LQ+LVP C + Sbjct: 115 SLGTETEQKKQQMEPTKDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNK 174 Query: 408 TDASGYKHSKAAVLQKSIDYIQYL 479 KA VL + I+YIQ L Sbjct: 175 V------IGKALVLDEIINYIQSL 192 >At1g59640.1 68414.m06707 basic helix-loop-helix (bHLH) family protein Length = 264 Score = 35.5 bits (78), Expect = 0.023 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 3/84 (3%) Frame = +3 Query: 237 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 407 S TE + + + + RR +A H+ AE+ RR+ I + LQ+LVP C + Sbjct: 115 SLGTETEQKKQQMEPTKDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNK 174 Query: 408 TDASGYKHSKAAVLQKSIDYIQYL 479 KA VL + I+YIQ L Sbjct: 175 V------IGKALVLDEIINYIQSL 192 >At3g57800.2 68416.m06443 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; supported by full-length cDNA gi:20127059 Length = 379 Score = 35.1 bits (77), Expect = 0.030 Identities = 23/82 (28%), Positives = 41/82 (50%) Frame = +3 Query: 234 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 413 SS+ +N E++ + + + ++H+ AE+ RR+ I LQELVP C + Sbjct: 185 SSTKKNKSSEENEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCDKIQ 244 Query: 414 ASGYKHSKAAVLQKSIDYIQYL 479 + A VL + I+++Q L Sbjct: 245 GT------ALVLDEIINHVQSL 260 >At5g62610.1 68418.m07857 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 281 Score = 34.7 bits (76), Expect = 0.040 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 4/107 (3%) Frame = +3 Query: 171 ICNMYSRCGSSGSIQNIHQTPSSSN-QNTEDEDDSGDNKASALSFKERRREA---HTQAE 338 +C S G GS++ +T S ++ + + + + RR +A H+ AE Sbjct: 110 LCGSESGNGD-GSMRPEGETSSGGGGSKATEQKNKPEPPKDYIHVRARRGQATDRHSLAE 168 Query: 339 QKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 + RR+ I + +LQ+++P C + KA VL + I+YIQ L Sbjct: 169 RARREKISEKMTALQDIIPGCNKI------IGKALVLDEIINYIQSL 209 >At3g57800.1 68416.m06442 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; supported by full-length cDNA gi:20127059 Length = 426 Score = 34.3 bits (75), Expect = 0.053 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +3 Query: 234 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQ-T 410 SS+ +N E++ + + + ++H+ AE+ RR+ I LQELVP C + T Sbjct: 185 SSTKKNKSSEENEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCDKGT 244 Query: 411 DASG 422 D G Sbjct: 245 DFGG 248 >At2g42300.1 68415.m05236 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 327 Score = 34.3 bits (75), Expect = 0.053 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 3/97 (3%) Frame = +3 Query: 198 SSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKG 368 SSG + + SS + + +S +K + + RR +A H+ AE+ RR+ I Sbjct: 153 SSGKRKEREKKVKSSTKKNKSSVES--DKLPYVHVRARRGQATDNHSLAERARREKINAR 210 Query: 369 YDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 LQELVP C + + A VL + I+++Q L Sbjct: 211 MKLLQELVPGCDKIQGT------ALVLDEIINHVQTL 241 >At5g50915.2 68418.m06314 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 286 Score = 33.9 bits (74), Expect = 0.070 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +3 Query: 318 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 ++H+ AE+ RR+ I + +LQ LVP C + KA +L + I+Y+Q L Sbjct: 145 DSHSLAERVRREKISERMRTLQNLVPGCDKVT------GKALMLDEIINYVQTL 192 >At5g50915.1 68418.m06313 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 286 Score = 33.9 bits (74), Expect = 0.070 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +3 Query: 318 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 ++H+ AE+ RR+ I + +LQ LVP C + KA +L + I+Y+Q L Sbjct: 145 DSHSLAERVRREKISERMRTLQNLVPGCDKVT------GKALMLDEIINYVQTL 192 >At4g01720.1 68417.m00223 WRKY family transcription factor similar to wild oat DNA-binding protein ABF2, GenBank accession number Z48431 Length = 489 Score = 33.9 bits (74), Expect = 0.070 Identities = 20/81 (24%), Positives = 31/81 (38%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 374 GSSG + S ++ D DD + S L + R + D + + Y+ Sbjct: 69 GSSGFNDGLGLVNSCHGTSSNDGDDKTKTQISRLKLELERLHEENHKLKHLLDEVSESYN 128 Query: 375 SLQELVPTCQQTDASGYKHSK 437 LQ V +QT G H + Sbjct: 129 DLQRRVLLARQTQVEGLHHKQ 149 >At5g48560.1 68418.m06005 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 498 Score = 33.1 bits (72), Expect = 0.12 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +3 Query: 318 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 ++H+ AE+ RR+ I + LQ+LVP C + KA +L + I+Y+Q L Sbjct: 310 DSHSLAERVRREKIGERMKLLQDLVPGCNKVT------GKALMLDEIINYVQSL 357 >At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763 Dehydrin ERD14 {Arabidopsis thaliana} Length = 185 Score = 32.7 bits (71), Expect = 0.16 Identities = 17/63 (26%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = +3 Query: 210 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGY-DSLQE 386 ++ +H++ SSS+ ++E+E G+ + K+ +++ T+ E K + KKG+ + L+E Sbjct: 71 LEKLHRSDSSSSSSSEEEGSDGEKRKK----KKEKKKPTTEVEVKEEE--KKGFMEKLKE 124 Query: 387 LVP 395 +P Sbjct: 125 KLP 127 >At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family protein bHLH protein, Arabidopsis thaliana, PATCHX:E255557 Length = 589 Score = 31.5 bits (68), Expect = 0.37 Identities = 19/70 (27%), Positives = 34/70 (48%) Frame = +3 Query: 324 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLXXXXXXX 503 H +AE++RR+ + + + SL+ +VP + D KA++L +I YI L Sbjct: 417 HVEAERQRREKLNQRFYSLRAVVPNVSKMD-------KASLLGDAISYISELKSKLQKAE 469 Query: 504 XXXNALRKDV 533 L+K + Sbjct: 470 SDKEELQKQI 479 >At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; PMID: 12679534 Length = 428 Score = 31.5 bits (68), Expect = 0.37 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 8/92 (8%) Frame = +3 Query: 228 TPSSSNQNTEDEDDSGDNKASALSF-KERRREAHTQ-------AEQKRRDAIKKGYDSLQ 383 T N DE+++ + + F KE RR+ + E++RR + + Y++L+ Sbjct: 175 TTQRDESNVGDENNNAQFDSGIIEFSKEIRRKGRGKRKNKPFTTERERRCHLNERYEALK 234 Query: 384 ELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 L+P+ + D +A++LQ IDYI L Sbjct: 235 LLIPSPSKGD-------RASILQDGIDYINEL 259 >At1g50410.1 68414.m05650 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 981 Score = 31.5 bits (68), Expect = 0.37 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 162 ITDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDN 281 + DI S G+S S QN Q SSS Q +D+DD D+ Sbjct: 770 VLDILQSLSNQGTSNSTQN-GQMASSSQQPNDDDDDDDDD 808 >At1g25330.1 68414.m03143 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 223 Score = 31.5 bits (68), Expect = 0.37 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +3 Query: 318 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 ++H+ AE+ RR+ I + LQ+LVP C + A G A +L IDY++ L Sbjct: 113 DSHSLAERVRREKINERLKCLQDLVPGCYK--AMG----MAVMLDVIIDYVRSL 160 >At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 590 Score = 31.5 bits (68), Expect = 0.37 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 4/76 (5%) Frame = +3 Query: 264 DDSGDNKASALSFKER--RREA--HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKH 431 D+SG+N+ + R EA H +AE++RR+ + + + +L+ +VP + D Sbjct: 410 DESGNNRPRKRGRRPANGRAEALNHVEAERQRREKLNQRFYALRSVVPNISKMD------ 463 Query: 432 SKAAVLQKSIDYIQYL 479 KA++L ++ YI L Sbjct: 464 -KASLLGDAVSYINEL 478 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 31.1 bits (67), Expect = 0.49 Identities = 14/77 (18%), Positives = 40/77 (51%) Frame = +3 Query: 225 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQ 404 ++ + ++ ED+ + DNK+ ++ ++ H +++ ++++ KK + L++ + Sbjct: 1072 ESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLEDQNSNKK 1131 Query: 405 QTDASGYKHSKAAVLQK 455 + D + K S+ L K Sbjct: 1132 KEDKNEKKKSQHVKLVK 1148 >At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 258 Score = 31.1 bits (67), Expect = 0.49 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 11/95 (11%) Frame = +3 Query: 228 TPSSSNQNTED----EDDSGDNKASALSFKERRREAHTQAE-------QKRRDAIKKGYD 374 T SN N D + S D KAS S K + R A +KRR+ I + Sbjct: 135 TVDESNTNWVDGQSLSNSSDDEKASVTSVKGKTRATKGTATDPQSLYARKRREKINERLK 194 Query: 375 SLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 +LQ LVP + D S +L++++ Y+++L Sbjct: 195 TLQNLVPNGTKVDIS-------TMLEEAVHYVKFL 222 >At1g25310.1 68414.m03141 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 145 Score = 31.1 bits (67), Expect = 0.49 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +3 Query: 327 TQAEQKRRDAIKKGYDSLQELVPTCQQTD 413 T ++KRR+ I++ ++L+E+ P C Q+D Sbjct: 72 TLLKKKRRERIRRQLETLKEITPNCPQSD 100 >At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putative (COX6b) nearly identical to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] GI:6518353 Length = 191 Score = 31.1 bits (67), Expect = 0.49 Identities = 20/73 (27%), Positives = 35/73 (47%) Frame = +3 Query: 225 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQ 404 QTPS S Q +++ D A + KE E TQAE+ + + K+ ++E V + Sbjct: 8 QTPSLSEQYHLEKEVKQDTSAKPVEVKEVAPEVTTQAEEVKTEQAKE-ESPVEEAVSVVE 66 Query: 405 QTDASGYKHSKAA 443 + S + ++ A Sbjct: 67 EKSESAPESTEVA 79 >At5g46760.1 68418.m05760 basic helix-loop-helix (bHLH) family protein Length = 592 Score = 30.3 bits (65), Expect = 0.86 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +3 Query: 324 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 H +AE++RR+ + + + SL+ +VP + D KA++L +I YI L Sbjct: 416 HVEAERQRREKLNQRFYSLRAVVPNVSKMD-------KASLLGDAISYINEL 460 >At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;annotation temporarily based on supporting cDNA gi|17224394|gb|AF246291.1|AF246291 Length = 637 Score = 30.3 bits (65), Expect = 0.86 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +3 Query: 324 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 H E+KRR+ + + + +L++++P+ + D K ++L +I+Y+Q L Sbjct: 442 HAVLEKKRREKLNERFMTLRKIIPSINKID-------KVSILDDTIEYLQEL 486 >At4g00870.1 68417.m00118 basic helix-loop-helix (bHLH) family protein similar to the myc family of helix-loop-helix transcription factors; contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain; PMID: 12679534 Length = 423 Score = 30.3 bits (65), Expect = 0.86 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Frame = +3 Query: 291 ALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSI 461 A + KE+ A H +AE++RR+ + + +L+ +VP + D KA++L ++ Sbjct: 236 AAATKEKHHPAVLSHVEAEKQRREKLNHRFYALRAIVPKVSRMD-------KASLLSDAV 288 Query: 462 DYIQYL 479 YI+ L Sbjct: 289 SYIESL 294 >At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to homeotic protein HAT 3.1 (GI:11994474) [Arabidopsis thaliana] Length = 723 Score = 30.3 bits (65), Expect = 0.86 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = +3 Query: 231 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELV 392 P N N DED S DN+ S T A + ++ K+G D +++++ Sbjct: 377 PDCLNDNENDEDGSDDNEESENEDGSSDETEFTSASDEMIESFKEGKDIMKDVM 430 >At2g44200.1 68415.m05500 expressed protein Length = 493 Score = 30.3 bits (65), Expect = 0.86 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +3 Query: 222 HQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIK 362 HQ SSS Q ++ E+DSG+ S ++ H + ++ R ++ Sbjct: 191 HQKQSSSRQRSDSEEDSGEENNGRKSHHQKTSGTHDRHYERPRSDLE 237 >At2g40200.1 68415.m04943 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 254 Score = 30.3 bits (65), Expect = 0.86 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = +3 Query: 276 DNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQK 455 D+ + E +H AE++RRD I +L++LVP + D KAA+L Sbjct: 51 DDCVGGIEKAESLSRSHRLAEKRRRDRINSHLTALRKLVPNSDKLD-------KAALLAT 103 Query: 456 SIDYIQYL 479 I+ ++ L Sbjct: 104 VIEQVKEL 111 >At1g63650.2 68414.m07202 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor (JAF13) GB:AAC39455 [Petunia x hybrida]; contains Pfam profile: PF00010 Helix-loop-helix DNA-binding domain Length = 596 Score = 30.3 bits (65), Expect = 0.86 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +3 Query: 324 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 H +E+KRR+ + + + +L+ ++P+ + D K ++L +I+Y+Q L Sbjct: 406 HALSEKKRREKLNERFMTLRSIIPSISKID-------KVSILDDTIEYLQDL 450 >At1g63650.1 68414.m07201 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor (JAF13) GB:AAC39455 [Petunia x hybrida]; contains Pfam profile: PF00010 Helix-loop-helix DNA-binding domain Length = 596 Score = 30.3 bits (65), Expect = 0.86 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +3 Query: 324 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 H +E+KRR+ + + + +L+ ++P+ + D K ++L +I+Y+Q L Sbjct: 406 HALSEKKRREKLNERFMTLRSIIPSISKID-------KVSILDDTIEYLQDL 450 >At1g61660.2 68414.m06950 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 347 Score = 30.3 bits (65), Expect = 0.86 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 6/94 (6%) Frame = +3 Query: 216 NIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR------RDAIKKGYDS 377 N TP + ED+ + +A + S K R ++ + A++ R K ++ Sbjct: 227 NFVTTPQIISTRLEDKTKNLKTRAQSESLK-RAKDNESAAKKPRVTTPSPLPTFKVRKEN 285 Query: 378 LQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 L++ + + QQ + K A+VLQ++I+YI++L Sbjct: 286 LRDQITSLQQLVSPFGKTDTASVLQEAIEYIKFL 319 >At1g61660.1 68414.m06949 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 393 Score = 30.3 bits (65), Expect = 0.86 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 6/94 (6%) Frame = +3 Query: 216 NIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR------RDAIKKGYDS 377 N TP + ED+ + +A + S K R ++ + A++ R K ++ Sbjct: 227 NFVTTPQIISTRLEDKTKNLKTRAQSESLK-RAKDNESAAKKPRVTTPSPLPTFKVRKEN 285 Query: 378 LQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 L++ + + QQ + K A+VLQ++I+YI++L Sbjct: 286 LRDQITSLQQLVSPFGKTDTASVLQEAIEYIKFL 319 >At5g37800.1 68418.m04552 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 307 Score = 29.9 bits (64), Expect = 1.1 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 1/104 (0%) Frame = +3 Query: 171 ICNMYSRCGSSGSIQNIHQTP-SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR 347 I N+ SR S+ ++ P + N + SG N ++ + A + R Sbjct: 160 IVNIGSRHESTSPKLAGNKRPFTGENTQLSKKPSSGTNGKIKPKATTSPKDPQSLAAKNR 219 Query: 348 RDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 R+ I + LQELVP G K +L+K+I Y+++L Sbjct: 220 RERISERLKVLQELVPN-------GTKVDLVTMLEKAIGYVKFL 256 >At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 566 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/52 (30%), Positives = 31/52 (59%) Frame = +3 Query: 324 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 H +AE++RR+ + + + +L+ +VP + D KA++L +I YI+ L Sbjct: 396 HVEAERQRREKLNQRFYALRSVVPNISKMD-------KASLLGDAISYIKEL 440 >At2g14760.1 68415.m01667 basic helix-loop-helix protein / bHLH protein contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain; PMID: 12679534; putative bHLH084 transcription factor Length = 328 Score = 29.9 bits (64), Expect = 1.1 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%) Frame = +3 Query: 261 EDDSGDNKASALSFKERR-REAHTQAE----QKRRDAIKKGYDSLQELVPTCQQTDASGY 425 ++D D+KA L+ K R R A T + +KRR+ I + LQ LVP + D S Sbjct: 222 KEDGEDSKALNLNGKTRASRGAATDPQSLYARKRRERINERLRILQHLVPNGTKVDIS-- 279 Query: 426 KHSKAAVLQKSIDYIQYL 479 +L++++ Y+++L Sbjct: 280 -----TMLEEAVQYVKFL 292 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 374 G G I++ + PS ED+ D G K S + + ++ + ++K++D K G + Sbjct: 121 GYGGRIESDYVKPSYGGH--EDDGDDGHKKHSGKDYDDGDEKSKKKEKEKKKDKKKDGNN 178 Query: 375 S 377 S Sbjct: 179 S 179 >At5g63720.1 68418.m07998 hypothetical protein Length = 492 Score = 29.1 bits (62), Expect = 2.0 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = +3 Query: 225 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGY-----DSLQEL 389 QTPS++ +EDE+ S + S + E TQAE + Y DS+ E+ Sbjct: 272 QTPSATGSESEDEEVSTSQEYSGETGSSSGSEWETQAENDTESKSESSYPPQNDDSVSEV 331 Query: 390 VPTCQQTD 413 + TD Sbjct: 332 STSPPHTD 339 >At5g43650.1 68418.m05335 basic helix-loop-helix (bHLH) family protein similar to unknown protein (pir||T04030) Length = 247 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/68 (25%), Positives = 35/68 (51%) Frame = +3 Query: 276 DNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQK 455 + K + ++ ++ R H E+ RR+ K+ Y +L L+P + D K ++++K Sbjct: 74 EEKKNTVAPEKERSRRHMLKERTRREKQKQSYLALHSLLPFATKND-------KNSIVEK 126 Query: 456 SIDYIQYL 479 ++D I L Sbjct: 127 AVDEIAKL 134 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/61 (27%), Positives = 21/61 (34%) Frame = +3 Query: 249 NTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYK 428 N D D G K + +ER RE EQ DA S E + G+ Sbjct: 20 NNNDNSDKGKEKEHDVRIRERERERDRAREQLNMDAAAAAARSADEDDDNDSEDGNGGFM 79 Query: 429 H 431 H Sbjct: 80 H 80 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/61 (27%), Positives = 21/61 (34%) Frame = +3 Query: 249 NTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYK 428 N D D G K + +ER RE EQ DA S E + G+ Sbjct: 93 NNNDNSDKGKEKEHDVRIRERERERDRAREQLNMDAAAAAARSADEDDDNDSEDGNGGFM 152 Query: 429 H 431 H Sbjct: 153 H 153 >At2g45130.1 68415.m05616 SPX (SYG1/Pho81/XPR1) domain-containing protein weak similarity to NUC-2 [Neurospora crassa] GI:1399532, xenotropic and polytropic murine leukemia virus receptor [Mus musculus castaneus] GI:6093320; contains Pfam profile PF03105: SPX domain Length = 245 Score = 29.1 bits (62), Expect = 2.0 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 6/89 (6%) Frame = +1 Query: 133 DKILRFQLYKSLIYATCTLGVVAVGLYKTSIKLRRLLIKIQKTKMTVEIIRHRHLVLKKG 312 DK LR++ K+LI + + + VGL I Q+ II H+ L + Sbjct: 20 DKFLRYKELKNLISSPAPVESIFVGLLNAEIDKFNAFFVEQEEDF---IIHHKELQYR-- 74 Query: 313 EEKLTPKQNRNEEM------PLRKDMIHF 381 ++L K N+EM +RKD+++F Sbjct: 75 IQRLVEKCGHNDEMSRENISEIRKDIVNF 103 >At1g68810.1 68414.m07866 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 368 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/54 (27%), Positives = 32/54 (59%) Frame = +3 Query: 318 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 ++H++AE++RR+ I L+ ++P +TD KA++L + I +++ L Sbjct: 176 KSHSEAERRRRERINNHLAKLRSILPNTTKTD-------KASLLAEVIQHVKEL 222 >At4g16430.1 68417.m02487 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 467 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +3 Query: 312 RREA--HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYI 470 R EA H +AE++RR+ + + + +L+ +VP + D KA++L +I YI Sbjct: 315 REEALNHVEAERQRREKLNQRFYALRAVVPNISKMD-------KASLLADAITYI 362 >At3g30725.1 68416.m03909 expressed protein ; expression supported by MPSS Length = 111 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +3 Query: 222 HQTPSSSNQNT--EDEDDSGDNKASALS 299 HQ PSSS+ N ++EDD GD A ++ Sbjct: 39 HQKPSSSSNNNHMDEEDDVGDKDAKPIT 66 >At2g20310.1 68415.m02372 expressed protein Length = 430 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 165 TDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDD 269 TDI + S G + + ++ P+SSNQ ED+DD Sbjct: 45 TDIVEVLSEV--RGGVNSQYRKPNSSNQALEDDDD 77 >At2g06210.2 68415.m00683 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 852 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +3 Query: 228 TPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPT 398 TP S+ + EDD G++K S ERRR+ + +K + + + Y+ +E T Sbjct: 691 TPGSNKRKDRVEDDDGESKPS-----ERRRKKGGKRRKKDKSSRARHYEDDEEEAAT 742 >At2g06210.1 68415.m00684 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 1064 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +3 Query: 228 TPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPT 398 TP S+ + EDD G++K S ERRR+ + +K + + + Y+ +E T Sbjct: 903 TPGSNKRKDRVEDDDGESKPS-----ERRRKKGGKRRKKDKSSRARHYEDDEEEAAT 954 >At1g66470.1 68414.m07551 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 298 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +3 Query: 315 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 ++ + A + RR+ I + LQELVP G K +L+K+I Y+++L Sbjct: 203 KDPQSLAAKNRRERISERLKILQELVPN-------GTKVDLVTMLEKAISYVKFL 250 >At4g29930.1 68417.m04258 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 254 Score = 28.3 bits (60), Expect = 3.5 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +3 Query: 333 AEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLL 482 +E+ RR + + +L+ +VP + D KA+V++ SIDY+Q L+ Sbjct: 58 SERNRRQKLNQRLFALRSVVPNISKLD-------KASVIKDSIDYMQELI 100 >At3g30775.1 68416.m03933 proline oxidase, mitochondrial / osmotic stress-responsive proline dehydrogenase (POX) (PRO1) (ERD5) nearly identical to SP|P92983 Proline oxidase, mitochondrial precursor (EC 1.5.3.-) (Osmotic stress- induced proline dehydrogenase) [Arabidopsis thaliana]; identical to cDNA proline oxidase precursor GI:1817543 Length = 499 Score = 28.3 bits (60), Expect = 3.5 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = +3 Query: 333 AEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQY 476 AE++R ++ + +QE+ CQ+++ ++ +LQ +IDY+ Y Sbjct: 252 AEEERE--LEAAHGRIQEICRKCQESNVPLLIDAEDTILQPAIDYMAY 297 >At3g20640.1 68416.m02612 ethylene-responsive protein -related contains similarity to ethylene-inducible ER33 protein [Lycopersicon esculentum] gi|5669656|gb|AAD46413 Length = 454 Score = 28.3 bits (60), Expect = 3.5 Identities = 21/82 (25%), Positives = 39/82 (47%) Frame = +3 Query: 234 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 413 S ++ +E G N + + + A KR++ + +LQ+LV +TD Sbjct: 309 SEIRDSSSNEVKRGGNDHQPAAKRAKSEAASPSPAFKRKEKMGDRIAALQQLVSPFGKTD 368 Query: 414 ASGYKHSKAAVLQKSIDYIQYL 479 A A+VL ++I+YI++L Sbjct: 369 A-------ASVLSEAIEYIKFL 383 >At2g22770.1 68415.m02701 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 314 Score = 28.3 bits (60), Expect = 3.5 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +3 Query: 324 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 H AE+KRR + + +L L+P ++TD KA VL+ +I +++ L Sbjct: 127 HVLAERKRRQKLNERLIALSALLPGLKKTD-------KATVLEDAIKHLKQL 171 >At2g02480.1 68415.m00187 DNA polymerase-related weak similarity to DNA polymerase III holoenzyme tau subunit [Thermus thermophilus] GI:2583049 Length = 1218 Score = 28.3 bits (60), Expect = 3.5 Identities = 19/88 (21%), Positives = 33/88 (37%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 374 GS S H S + +DD +++K+R H IK+ + Sbjct: 800 GSMPSPGTTHTGSSRRQSSRATDDDPASVSREVMAYKQRIGGLHFSKSASPASVIKRNGN 859 Query: 375 SLQELVPTCQQTDASGYKHSKAAVLQKS 458 E P + D + YK S ++ + +S Sbjct: 860 HSHEAKPFSRVIDNNCYKSSSSSQMIES 887 >At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein (RAP-1) identical to bHLH protein GB:CAA67885 GI:1465368 from [Arabidopsis thaliana] Length = 623 Score = 28.3 bits (60), Expect = 3.5 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = +3 Query: 324 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 H +AE++RR+ + + + +L+ +VP + D KA++L +I YI L Sbjct: 453 HVEAERQRREKLNQRFYALRAVVPNVSKMD-------KASLLGDAIAYINEL 497 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.9 bits (59), Expect = 4.6 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = +3 Query: 210 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAE 338 +++IH + S +Q+ +DD+G++ S+L E + E H ++ Sbjct: 593 LEHIHSS-KSEDQSVYSDDDAGESGESSLHRIEAKEEEHISSD 634 >At3g25710.1 68416.m03199 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 344 Score = 27.9 bits (59), Expect = 4.6 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +3 Query: 318 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 413 ++H++AE++RR+ I L+ ++P +TD Sbjct: 134 KSHSEAERRRRERINTHLAKLRSILPNTTKTD 165 >At3g21480.1 68416.m02710 transcription activation domain-interacting protein-related contains weak similarity to Pax transcription activation domain interacting protein PTIP (GI:4336734) [Mus musculus] Length = 1045 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 243 NQNTEDEDDSGDNKASALSFKERRREAHTQAE 338 N + D DDSG + LS +E R++A+ + + Sbjct: 128 NSDLSDSDDSGSKAETVLSSEENRQDANEKVK 159 >At1g17820.1 68414.m02206 expressed protein Length = 803 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/65 (23%), Positives = 33/65 (50%) Frame = +3 Query: 195 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 374 GSS + + Q+PS S ++E++D G + + ++ + E+KRR +K Sbjct: 736 GSSREVSAV-QSPSRSVASSEEDDSRGKKQGRRARMLDLGKKMGEKLEEKRRHMEEKSRQ 794 Query: 375 SLQEL 389 ++++ Sbjct: 795 IVEKM 799 >At5g41090.1 68418.m04995 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to unknown protein (emb|CAB88055.1) Length = 212 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 216 NIHQTPSSSNQNTEDEDDSGDNKASAL-SFKER 311 N+H S S E+ED+S D A +L S KE+ Sbjct: 168 NLHIVESESESEEEEEDESVDKPAESLDSVKEK 200 >At4g09820.1 68417.m01611 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 379 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = +3 Query: 321 AHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 479 +H AE++RR+ + + + +L+ +VP + D K ++L +I Y+ +L Sbjct: 224 SHVVAERRRREKLNEKFITLRSMVPFVTKMD-------KVSILGDTIAYVNHL 269 >At4g04890.1 68417.m00712 homeobox-leucine zipper protein protodermal factor 2 (PDF2) identical to GP|14276060| protodermal factor2 (GI:14276060) Length = 743 Score = 27.5 bits (58), Expect = 6.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 253 QKTKMTVEIIRHRHLVLKKGEEKLTPKQNRNEE 351 ++T+M + RH + +LK +KL + NR +E Sbjct: 113 KRTQMKAQSERHENQILKSDNDKLRAENNRYKE 145 >At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family protein similar to Mrs16p (GI:2737884) [Saccharomyces cerevisiae]; weak similarity to ataxin-2 related protein (GI:1679686) [Homo sapiens] Length = 595 Score = 27.5 bits (58), Expect = 6.1 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 198 SSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDA 356 SS +N+ Q+ S+S Q ++D +G N S E+RR+ + + R A Sbjct: 330 SSRKNKNVDQSCSTSKQQSKDFPAAGSN-ISESQLDEQRRKNNEEVSHNNRSA 381 >At2g03810.2 68415.m00341 18S pre-ribosomal assembly protein gar2-related contains weak similarity to Swiss-Prot:P41891 protein gar2 [Schizosaccharomyces pombe] Length = 439 Score = 27.5 bits (58), Expect = 6.1 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +3 Query: 177 NMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHT--QAEQKRR 350 N C + G I + S NQ+ D + S L KE+R T + E ++ Sbjct: 242 NDSKECLTLGDILSREDEQKSLNQDNISSDSHEEQSPSQLQDKEKRSLETTAIETELEKT 301 Query: 351 DAIKKGYDSLQELVPTCQQ 407 + K+G + L + T Q Sbjct: 302 EEPKQGEEKLSSVSTTTSQ 320 >At2g03810.1 68415.m00340 18S pre-ribosomal assembly protein gar2-related contains weak similarity to Swiss-Prot:P41891 protein gar2 [Schizosaccharomyces pombe] Length = 439 Score = 27.5 bits (58), Expect = 6.1 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +3 Query: 177 NMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHT--QAEQKRR 350 N C + G I + S NQ+ D + S L KE+R T + E ++ Sbjct: 242 NDSKECLTLGDILSREDEQKSLNQDNISSDSHEEQSPSQLQDKEKRSLETTAIETELEKT 301 Query: 351 DAIKKGYDSLQELVPTCQQ 407 + K+G + L + T Q Sbjct: 302 EEPKQGEEKLSSVSTTTSQ 320 >At1g77500.1 68414.m09025 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 879 Score = 27.5 bits (58), Expect = 6.1 Identities = 28/110 (25%), Positives = 50/110 (45%) Frame = +1 Query: 190 GVVAVGLYKTSIKLRRLLIKIQKTKMTVEIIRHRHLVLKKGEEKLTPKQNRNEEMPLRKD 369 G ++ + T +R+LL KI +V+ I R + K +E+L P+ + L Sbjct: 584 GAESIKIDATRAAIRKLLTKIDVCIRSVDSISSR--IHKLRDEELQPQL-----IQLIHG 636 Query: 370 MIHFKSWFLPVNKLMHQAISTVKLQSFKNP*TISNTYYSKGVVKRKNEMR 519 +I L ++ QAI K++S K T+ N S ++ + E+R Sbjct: 637 LIRMWRSMLRCHQKQFQAIRESKVRSLKANTTLQNDSGSTAILDLEIELR 686 >At1g57680.2 68414.m06546 expressed protein Length = 362 Score = 27.5 bits (58), Expect = 6.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 416 CISLLTGRNQLLK*IISFLNGISSFLFCL 330 C+S+LT ++++ +SFL +S F FC+ Sbjct: 256 CLSVLTAADKIIFEALSFLAFLSLFCFCV 284 >At1g57680.1 68414.m06545 expressed protein Length = 362 Score = 27.5 bits (58), Expect = 6.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 416 CISLLTGRNQLLK*IISFLNGISSFLFCL 330 C+S+LT ++++ +SFL +S F FC+ Sbjct: 256 CLSVLTAADKIIFEALSFLAFLSLFCFCV 284 >At1g52160.1 68414.m05887 metallo-beta-lactamase family protein Length = 890 Score = 27.5 bits (58), Expect = 6.1 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +3 Query: 201 SGSIQNIHQTPSSSNQNTEDEDDSGDNKAS-ALSFKERRREAHTQAEQKRRDAIKKGYDS 377 S S+ + + SSS+ +E +G +S + F +RR E ++K+R+ +K Sbjct: 36 SFSLSTLFSSSSSSSSMENNEATNGSKSSSNSFVFNKRRAEGFDITDKKKRNLERKS--- 92 Query: 378 LQELVPT 398 Q+L PT Sbjct: 93 -QKLNPT 98 >At1g14687.1 68414.m01755 zinc finger homeobox family protein / ZF-HD homeobox family protein Length = 168 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 234 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIK 362 ++ +N E+EDD+ + +RRR++ AEQ R+A+K Sbjct: 82 TAEERNEEEEDDTEETSTEEKMTVQRRRKSKFTAEQ--REAMK 122 >At1g10610.1 68414.m01202 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 421 Score = 27.5 bits (58), Expect = 6.1 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 3/89 (3%) Frame = +3 Query: 225 QTPSSSNQNTEDE--DDSGDNKASA-LSFKERRREAHTQAEQKRRDAIKKGYDSLQELVP 395 QTP +D ++ D+KA+ L E + + +E+KRR+ I + L+ +VP Sbjct: 229 QTPCLIMNKEKDVVVQNANDSKANKKLLPTENFKSKNLHSERKRRERINQAMYGLRAVVP 288 Query: 396 TCQQTDASGYKHSKAAVLQKSIDYIQYLL 482 K +K + ++DYI LL Sbjct: 289 KIT-------KLNKIGIFSDAVDYINELL 310 >At5g56960.1 68418.m07110 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 466 Score = 27.1 bits (57), Expect = 8.0 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 3/94 (3%) Frame = +3 Query: 177 NMYSRCGSSGSIQNIHQTPSSSNQN--TEDEDDSGDNKASAL-SFKERRREAHTQAEQKR 347 +M +R S + NI+Q + +N T E G S + H +E+KR Sbjct: 238 SMMTRAMSFYNRLNINQRERFTRENATTHGEGSGGSGGGGRYTSGPSATQLQHMISERKR 297 Query: 348 RDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVL 449 R+ + + + +L+ L+P G K KA+VL Sbjct: 298 REKLNESFQALRSLLP-------PGTKKDKASVL 324 >At4g33880.1 68417.m04807 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 352 Score = 27.1 bits (57), Expect = 8.0 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 7/82 (8%) Frame = +3 Query: 255 EDEDDSGDNKASALSFKERRREAHTQAE-------QKRRDAIKKGYDSLQELVPTCQQTD 413 ED D+ + AL+ + R + A +KRR+ I + LQ LVP + D Sbjct: 247 EDSSSKEDDPSKALNLNGKTRASRGAATDPQSLYARKRRERINERLRILQNLVPNGTKVD 306 Query: 414 ASGYKHSKAAVLQKSIDYIQYL 479 S +L++++ Y+++L Sbjct: 307 IS-------TMLEEAVHYVKFL 321 >At4g29550.1 68417.m04214 expressed protein contains Pfam profile PF04776: Protein of unknown function (DUF626) Length = 358 Score = 27.1 bits (57), Expect = 8.0 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +3 Query: 165 TDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA 323 T + + S CG + +++ P S + T+++DD+ D +S+ KE +A Sbjct: 13 TTVSHDVSSCGFISKEEWLNKHPPSGSGWTDEDDDNDDVFSSSFISKEELSDA 65 >At4g27290.1 68417.m03916 S-locus protein kinase, putative similar to S-receptor kinase gi|392557|gb|AAA62232; contains Pfam domains PF00954: S-locus glycoprotein family, PF00069: Protein kinase domain and PF01453: Lectin (probable mannose binding) Length = 772 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 168 DICNMYSRCGSSGSIQNIHQTPS 236 D C+ Y+ CGS GS NI+++P+ Sbjct: 278 DSCDQYTLCGSYGSC-NINESPA 299 >At3g29763.1 68416.m03760 hypothetical protein Length = 505 Score = 27.1 bits (57), Expect = 8.0 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 271 VEIIRHRHLVLKKGEEKLTPKQNRNEEMPLRKDMIH 378 ++ I ++ V+KK K PK N+ P++KD++H Sbjct: 78 LKYIAGQNEVVKKVVLKNAPKNNQMTSPPIQKDIVH 113 >At2g28160.1 68415.m03420 basic helix-loop-helix (bHLH) family protein Length = 318 Score = 27.1 bits (57), Expect = 8.0 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 8/83 (9%) Frame = +3 Query: 255 EDEDD--SGDNKASALSFKERRREAHTQ------AEQKRRDAIKKGYDSLQELVPTCQQT 410 EDE+D GD+ ++ + + R+ T +E++RR +K +L+ LVP + Sbjct: 101 EDEEDYNDGDDSSATTTNNDGTRKTKTDRSRTLISERRRRGRMKDKLYALRSLVPNITKM 160 Query: 411 DASGYKHSKAAVLQKSIDYIQYL 479 D KA+++ ++ Y+Q L Sbjct: 161 D-------KASIVGDAVLYVQEL 176 >At2g16910.1 68415.m01948 basic helix-loop-helix (bHLH) family protein Length = 571 Score = 27.1 bits (57), Expect = 8.0 Identities = 21/82 (25%), Positives = 39/82 (47%) Frame = +3 Query: 234 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 413 S + +DEDD K S + + + AE++RR + +L+ LVP + D Sbjct: 289 SDCSDQIDDEDDPKYKKKSGKGSQAK----NLMAERRRRKKLNDRLYALRSLVPRITKLD 344 Query: 414 ASGYKHSKAAVLQKSIDYIQYL 479 +A++L +I+Y++ L Sbjct: 345 -------RASILGDAINYVKEL 359 >At1g29570.1 68414.m03616 zinc finger protein-related contains similarity to zinc finger proteins (CCCH type) Length = 321 Score = 27.1 bits (57), Expect = 8.0 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +3 Query: 207 SIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR-RDAIKKGYDSLQ 383 ++Q Q S Q E E++ + + S + +RREA +Q+R RD+I++ Q Sbjct: 186 NLQEQRQRDSIERQRREAEENLQEQRQRD-SIERQRREAQENLQQQRQRDSIERQRREAQ 244 Query: 384 E 386 E Sbjct: 245 E 245 >At1g19260.1 68414.m02396 hAT dimerisation domain-containing protein Length = 769 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +1 Query: 271 VEIIRH---RHLVLKKGEEKLTPKQNRNEEMPLRKDMIH 378 VE++++ ++ V+KK K PK N+ P++KD++H Sbjct: 207 VELLKYTAGQNEVVKKVVLKNAPKNNQMTSPPIQKDIVH 245 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,622,598 Number of Sequences: 28952 Number of extensions: 208458 Number of successful extensions: 1124 Number of sequences better than 10.0: 118 Number of HSP's better than 10.0 without gapping: 1064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1111 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1003808112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -