BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M19 (377 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79720.1 68414.m09298 aspartyl protease family protein contai... 29 1.4 At4g35640.1 68417.m05061 serine O-acetyltransferase, putative si... 27 4.1 At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing pro... 26 7.2 At4g15093.1 68417.m02319 catalytic LigB subunit of aromatic ring... 26 7.2 At5g40450.1 68418.m04905 expressed protein 26 9.6 At3g11950.1 68416.m01473 UbiA prenyltransferase family protein c... 26 9.6 At2g34357.1 68415.m04206 expressed protein 26 9.6 At2g17640.1 68415.m02040 serine O-acetyltransferase, putative (S... 26 9.6 >At1g79720.1 68414.m09298 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 484 Score = 28.7 bits (61), Expect = 1.4 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 35 VKMKVAPVLFVVLLSLMCVVQCKDLIVGTSFNNRLIWQEKADYNA 169 + + +AP+L V L L CVV D S +N IW K Y A Sbjct: 7 LNLSLAPLLLVFLFLLSCVVHGVDEKKILSVHNN-IWSPKKSYEA 50 >At4g35640.1 68417.m05061 serine O-acetyltransferase, putative similar to serine acetyltransferase, Arabidopsis thaliana, GI:905391; contains Pfam profile PF00132: Bacterial transferase hexapeptide (four repeats) Length = 355 Score = 27.1 bits (57), Expect = 4.1 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +2 Query: 140 IWQEKADYNAIPLKKRVKEVFFSD--PGQQIIKGVIARDLDH-TDAIASITA 286 +W++ A+ L+ RV EVF D P +I KG++ LDH T + TA Sbjct: 184 LWKQGRKLLALALQSRVSEVFGIDIHPAARIGKGIL---LDHGTGVVIGETA 232 >At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing protein similar to meiotic asynaptic mutant 1 [Arabidopsis thaliana] GI:7939627, aysnaptic 1 [Brassica oleracea var. alboglabra] GI:23506946; contains Pfam profile PF02301: HORMA domain Length = 1399 Score = 26.2 bits (55), Expect = 7.2 Identities = 19/66 (28%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = +2 Query: 14 SIYTINFVKMKVAPVLFVVLLSLMCV-VQCKDLIVGTSFNNRLI-WQEKADYNAIPLKKR 187 +I+ I++++ + PV + +S+ + ++ K L+ + + RLI W EK Y+A+ KK Sbjct: 23 AIFNISYIR-GLFPVRYFKDMSVPALDLKMKKLMPMDAESRRLIGWMEKGVYDALH-KKH 80 Query: 188 VKEVFF 205 +K++ F Sbjct: 81 LKKLIF 86 >At4g15093.1 68417.m02319 catalytic LigB subunit of aromatic ring-opening dioxygenase family contains Pfam PF02900: Catalytic LigB subunit of aromatic ring-opening dioxygenase Length = 269 Score = 26.2 bits (55), Expect = 7.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 167 AIPLKKRVKEVFFSDPGQQIIKGVIARDLDH 259 AI L KRVKE+ + G + + R LDH Sbjct: 87 AIELGKRVKELLMKEGGMKRVDEDTKRGLDH 117 >At5g40450.1 68418.m04905 expressed protein Length = 2910 Score = 25.8 bits (54), Expect = 9.6 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 2/62 (3%) Frame = +2 Query: 101 KDLIVGTSFNNRLIWQEKADYNAIPLKKRVKEVFFSDPGQQIIKGVI--ARDLDHTDAIA 274 ++L VG F +R +E+ +NA+ ++ + EV S+ GVI A + +H D + Sbjct: 2425 RELEVGNDFVSRDGEKEEVPHNALENEEEMNEVVASEKQISDPVGVIKKASEAEHEDPVD 2484 Query: 275 SI 280 I Sbjct: 2485 DI 2486 >At3g11950.1 68416.m01473 UbiA prenyltransferase family protein contains Pfam profile PF01040: UbiA prenyltransferase family Length = 954 Score = 25.8 bits (54), Expect = 9.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 34 CKNEGCTSFVCCSSILN 84 C+NEGCT+ C + + N Sbjct: 195 CENEGCTAVFCANQMEN 211 >At2g34357.1 68415.m04206 expressed protein Length = 1280 Score = 25.8 bits (54), Expect = 9.6 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 136 TNMARKSRLQCHPIEEKS*RSFLFGSWATNYKGCNCP 246 ++ A+K +LQ P+ +S S ++ WA CN P Sbjct: 529 SHKAQKLKLQGLPVASRSVDSLVYSLWALLPSFCNYP 565 >At2g17640.1 68415.m02040 serine O-acetyltransferase, putative (SAT-106) similar to Arabidopsis thaliana serine acetyltransferase GI:905391 Length = 323 Score = 25.8 bits (54), Expect = 9.6 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +2 Query: 140 IWQEKADYNAIPLKKRVKEVFFSD--PGQQIIKGVIARDLDH-TDAIASITA 286 +W E A+ L+ R+ EVF D P +I +G++ LDH T + TA Sbjct: 147 LWNEGRKLLALALQSRISEVFGIDIHPAARIGEGIL---LDHGTGVVIGETA 195 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,446,644 Number of Sequences: 28952 Number of extensions: 172966 Number of successful extensions: 404 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 517767328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -