BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M17 (530 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.64 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 24 0.84 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 3.4 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 7.9 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 24.6 bits (51), Expect = 0.64 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 405 NVWLWTAITLDGTSHTTHLEMYFT 334 N WLWT G ++ ++E+ FT Sbjct: 70 NNWLWTPFIERGPANRMYIEIKFT 93 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 24.2 bits (50), Expect = 0.84 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -3 Query: 222 NGIVLNFRTHEPAYPRSWLCAFSFPSIYN 136 NG +L+ H+ W+C + IYN Sbjct: 361 NGNILSPSIHDNICSNGWICEHRWRQIYN 389 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 3.4 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -3 Query: 414 GMSNVWLWTAITLDGTSHTTHLEMYFTISFPSTGII 307 G S V + AI G TH Y I F GI+ Sbjct: 134 GWSAVVITAAICTSGIVGRTHTVGYIIIGFLLAGIV 169 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 7.9 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 234 SQKRNGIVLNFRTHEPAYPRSWLCAFSFPS 145 SQ + G+ R+ EP Y FSFP+ Sbjct: 594 SQIQRGVNAAIRSQEPFYITEPHQIFSFPA 623 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,950 Number of Sequences: 438 Number of extensions: 3786 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -