BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M16 (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36805| Best HMM Match : GED (HMM E-Value=0.24) 30 1.4 SB_36351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_59317| Best HMM Match : APT (HMM E-Value=7.8) 28 5.8 SB_49621| Best HMM Match : 7tm_1 (HMM E-Value=6e-12) 28 5.8 SB_29242| Best HMM Match : CIDE-N (HMM E-Value=5) 28 5.8 SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_22879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 >SB_36805| Best HMM Match : GED (HMM E-Value=0.24) Length = 377 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 139 QDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRIGYLPKYY 288 + V QV + ++ K G+ +D +I+N ++K V +LK Y KYY Sbjct: 49 EGVGQVVIHRKFMKPGELFDFPVSIENGKSRKFVSNWLKKYPWLAYSKYY 98 >SB_36351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = +3 Query: 48 PVWCHRKRITS----DKRCRRSVCGAPEKGFIP 134 P+W H K +++ + CRRSV P G++P Sbjct: 36 PIWWHGKPMSNLRYPNVTCRRSVLDRPNPGYVP 68 >SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 85 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKA-VEEF 249 KD D V +QK VL + + + +++ K+ +DY VE ++ KK V +F Sbjct: 401 KDADIAPVPKQKPVLDINKHLRPISLTPVLSKLAEDYIVEQHLKPAVLKKVDVNQF 456 >SB_59317| Best HMM Match : APT (HMM E-Value=7.8) Length = 229 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 85 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKA-VEEF 249 KD D V +QK VL + + + +++ K+ +DY VE ++ KK V +F Sbjct: 35 KDADIAPVPKQKPVLDVNKHLRPISLTPVLSKLAEDYVVEQHLKPAVLKKVDVNQF 90 >SB_49621| Best HMM Match : 7tm_1 (HMM E-Value=6e-12) Length = 316 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 645 VGIVGVIHILLFLLYNSIINSLCIVKNTV 559 VG + + +ILLF + +I ++C+V NTV Sbjct: 168 VGFLALNNILLFKVVGCVIITICLVLNTV 196 >SB_29242| Best HMM Match : CIDE-N (HMM E-Value=5) Length = 279 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 85 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKA-VEEF 249 KD D V +QK VL + + + +++ K+ +DY VE ++ KK V +F Sbjct: 108 KDADIAPVPKQKPVLDVNKHLRPISLTPVLSKLAEDYVVEQHLKPAVLKKVDVNQF 163 >SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1460 Score = 28.3 bits (60), Expect = 5.8 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 118 KKVLSLFQDVDQVNVDDEYYKIGKDY-DVEAN-IDNYTNKKAVEEFLKLYRI 267 ++ +SLF+DVD+ D+ Y KI Y D+ + ID Y + F KL ++ Sbjct: 93 ERCISLFKDVDKYKHDERYLKIWIQYADLCTDPIDVYDYMHSQSMFSKLAKL 144 >SB_22879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = -1 Query: 645 VGIVGVIHILLFLLYNSIINSLCIVKNTVLHFSAINLK*SVHINEELWINFI 490 + I+ +I+I++ ++ IIN + I+ N +++ IN+ ++I + IN I Sbjct: 24 INIIIIINIIINIIIIIIINIIIIIINIIINIIIINIIIIINIIINIIINII 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,942,568 Number of Sequences: 59808 Number of extensions: 421465 Number of successful extensions: 1692 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1689 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -