BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M15 (612 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 26 0.29 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 26 0.29 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 26 0.29 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 26 0.29 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 2.0 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 6.2 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 25.8 bits (54), Expect = 0.29 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 601 ISIGYSATWPYILVLTCGYVL--GTGRPAYLLIFGLTATFENISCLRPE 461 +S GY+ ++V T + G G P+ + + +T +F +CL P+ Sbjct: 976 LSTGYALIMMAVIVGTALQLREDGVGSPSAIFLIAMTGSFFIAACLHPQ 1024 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 25.8 bits (54), Expect = 0.29 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 601 ISIGYSATWPYILVLTCGYVL--GTGRPAYLLIFGLTATFENISCLRPE 461 +S GY+ ++V T + G G P+ + + +T +F +CL P+ Sbjct: 976 LSTGYALIMMAVIVGTALQLREDGVGSPSAIFLIAMTGSFFIAACLHPQ 1024 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 25.8 bits (54), Expect = 0.29 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 601 ISIGYSATWPYILVLTCGYVL--GTGRPAYLLIFGLTATFENISCLRPE 461 +S GY+ ++V T + G G P+ + + +T +F +CL P+ Sbjct: 976 LSTGYALIMMAVIVGTALQLREDGVGSPSAIFLIAMTGSFFIAACLHPQ 1024 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 25.8 bits (54), Expect = 0.29 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 601 ISIGYSATWPYILVLTCGYVL--GTGRPAYLLIFGLTATFENISCLRPE 461 +S GY+ ++V T + G G P+ + + +T +F +CL P+ Sbjct: 976 LSTGYALIMMAVIVGTALQLREDGVGSPSAIFLIAMTGSFFIAACLHPQ 1024 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 Query: 59 RHAQDLTRRGRLH 21 +HA DL RRG LH Sbjct: 623 KHALDLDRRGLLH 635 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 59 RHAQDLTRRGRLH 21 +HA DL R+G LH Sbjct: 623 KHALDLDRQGLLH 635 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,826 Number of Sequences: 336 Number of extensions: 3023 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -