BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M15 (612 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 1.8 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.4 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.2 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 9.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.5 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 1.8 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 339 NSP-KVPTYLQLPTSRMASTTAYPKSTTINITSLSG 443 NSP P YL + ST+ P S+T LSG Sbjct: 821 NSPASSPRYLSAAATSSTSTSPRPASSTAATLVLSG 856 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 5.4 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +2 Query: 239 DMKYVYIIAGISV---VLLLCIIIGTVRCVMSRHNIEQPKGPDVSATTDIPNG 388 D V IIAG V VLL+ III TV + + K P T + NG Sbjct: 527 DNMQVRIIAGAIVAVVVLLVIIIIMTVLILRRASDECNKKQPSDCDTLEYRNG 579 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 405 PKSTTINITSLSGPVDSVDSGLKQE 479 P STT+N + SG + S G+K E Sbjct: 279 PNSTTMNGSPGSGGIRSDQMGVKIE 303 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/19 (36%), Positives = 8/19 (42%) Frame = -3 Query: 133 WNSGHSWSRRHC*FNPPPV 77 W SW H F P P+ Sbjct: 222 WEQNRSWRITHSYFMPDPL 240 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +2 Query: 23 EVAHDVSDLEHDDV 64 E+ +V D+E+DD+ Sbjct: 291 EIKKEVEDMEYDDI 304 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,425 Number of Sequences: 438 Number of extensions: 3723 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -