BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M13 (630 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79640.1 68414.m09286 protein kinase family protein contains ... 31 0.63 At4g36080.1 68417.m05136 FAT domain-containing protein / phospha... 28 5.9 >At1g79640.1 68414.m09286 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 694 Score = 31.1 bits (67), Expect = 0.63 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 70 RPDKPDLKQLKAEAA--RKKACLHDCTNVKFEPICASKNGEKPKSFGSVCVMNN 225 +P P ++ EAA R+K LHD T++++ ICA + +K K+ + M+N Sbjct: 641 QPTVPPTEKSMLEAAHEREKELLHDITDLQWRLICAEEELQKYKTEHAQVSMSN 694 >At4g36080.1 68417.m05136 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF02259: FAT domain, PF02260: FATC domain Length = 3839 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 246 YTAESRRWRVCWFRRNSPLLI*TTKPQW 329 +TAE + C+FR +S +L+ TKPQ+ Sbjct: 39 HTAEYLNFLKCYFRASSVILLQITKPQF 66 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,718,571 Number of Sequences: 28952 Number of extensions: 248924 Number of successful extensions: 499 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -