BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M06 (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24977| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_31855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_31075| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_12417| Best HMM Match : Antimicrobial11 (HMM E-Value=7.9) 29 2.2 SB_27650| Best HMM Match : Binary_toxA (HMM E-Value=8.2) 29 2.8 SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) 28 3.8 SB_47760| Best HMM Match : DUF1168 (HMM E-Value=2.1) 28 3.8 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_6912| Best HMM Match : rve (HMM E-Value=4.8e-35) 28 5.0 SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) 27 6.6 SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 6.6 SB_26858| Best HMM Match : ANF_receptor (HMM E-Value=2.4e-15) 27 6.6 SB_11854| Best HMM Match : Neuromodulin (HMM E-Value=7.3) 27 6.6 SB_56875| Best HMM Match : LON (HMM E-Value=0) 27 8.7 SB_49825| Best HMM Match : cobW (HMM E-Value=7.6) 27 8.7 SB_7865| Best HMM Match : Mucin (HMM E-Value=1.2) 27 8.7 >SB_24977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 7/75 (9%) Frame = +3 Query: 222 DLEEINSIFKIPNQ-APTTTKKPTMTVSAPSAVPTVNTNGNRGRYDTDP----DDINSVF 386 D+E ++++ N +P+ K + VSA + + GN+G + P + I+ +F Sbjct: 61 DIEAYSTLYPETNSDSPSVKSKGALLVSAKAEAKNIIAAGNKGNINQVPLLWANTISEIF 120 Query: 387 KIPTQAPGT--VNPV 425 K PT +NP+ Sbjct: 121 KEPTHKMTVMMINPI 135 >SB_31855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 7/75 (9%) Frame = +3 Query: 222 DLEEINSIFKIPNQ-APTTTKKPTMTVSAPSAVPTVNTNGNRGRYDTDP----DDINSVF 386 D+E ++++ N +P+ K + VSA + + GN+G + P + I+ +F Sbjct: 61 DIEAYSTLYPETNSDSPSVKSKGALLVSAKAEAKNIIAAGNKGNINQVPLLWANTISEIF 120 Query: 387 KIPTQAPGT--VNPV 425 K PT +NP+ Sbjct: 121 KEPTHKMTVMMINPI 135 >SB_31075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 7/75 (9%) Frame = +3 Query: 222 DLEEINSIFKIPNQ-APTTTKKPTMTVSAPSAVPTVNTNGNRGRYDTDP----DDINSVF 386 D+E ++++ N +P+ K + VSA + + GN+G + P + I+ +F Sbjct: 61 DIEAYSTLYPETNSDSPSVKSKGALLVSAKAEAKNIIAAGNKGNINQVPLLWANTISEIF 120 Query: 387 KIPTQAPGT--VNPV 425 K PT +NP+ Sbjct: 121 KEPTHKMTVMMINPI 135 >SB_12417| Best HMM Match : Antimicrobial11 (HMM E-Value=7.9) Length = 219 Score = 29.1 bits (62), Expect = 2.2 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 10/82 (12%) Frame = +3 Query: 210 ANDIDLEEINSIFKIPNQAPTTTKKPTM--------TVSAPSAVPTV--NTNGNRGRYDT 359 A D L++++SI K P+ +P +KP M T+ AP +P + + + GR Sbjct: 124 ARDPSLKQLDSILK-PSDSPP--RKPGMLKHRESAPTLHAPRTIPRDLRSMSHDSGRVPR 180 Query: 360 DPDDINSVFKIPTQAPGTVNPV 425 DP+ IP +PGT++PV Sbjct: 181 DPE------LIPLSSPGTLSPV 196 >SB_27650| Best HMM Match : Binary_toxA (HMM E-Value=8.2) Length = 159 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 213 NDIDLEEINSIFKIPNQAPTTTKKPTMTVSAPSAVPTVNT 332 ++ID E N I + N +TK PTM SA P++NT Sbjct: 108 SEIDASEGNKIIGLDNSILASTKPPTMK-RVRSAGPSLNT 146 >SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) Length = 1452 Score = 28.3 bits (60), Expect = 3.8 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 195 HAQANANDIDLEEINSIFKIPNQAPTTTKKPTMTVSAPSAVP-TVNTNGN 341 H +++A +E INSI + + PTTT++ +V P +N NG+ Sbjct: 588 HLESHAGHYPIETINSIRQRHGRPPTTTEELLNSVPQGDTDPNALNRNGD 637 >SB_47760| Best HMM Match : DUF1168 (HMM E-Value=2.1) Length = 438 Score = 28.3 bits (60), Expect = 3.8 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 11/81 (13%) Frame = +3 Query: 216 DIDLEEINSIFKIPNQAPTTTKKPT-MTVSAPSAVPTVNTNGNRGRY------DTDP--- 365 D+D+ +N +FK N+A T +P+ +T S T + GR D P Sbjct: 256 DLDVAFVNPMFK--NRAKITETEPSPITPEDESMASTGEISSEEGRVNPLFEPDRSPNGS 313 Query: 366 -DDINSVFKIPTQAPGTVNPV 425 DD+ ++ IP+ G VNP+ Sbjct: 314 EDDLPTIPNIPSTDEGQVNPL 334 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 27.9 bits (59), Expect = 5.0 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +3 Query: 210 ANDI----DLEEINSIFKIPNQAPTTTKKPTMTVSAPSAVP 320 AND+ +L ++ +P Q P K+P +TVS PS P Sbjct: 1204 ANDLQSSTELAQVPMQTTVPKQIPEEFKEPEITVSEPSLEP 1244 >SB_6912| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 440 Score = 27.9 bits (59), Expect = 5.0 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +3 Query: 210 ANDI----DLEEINSIFKIPNQAPTTTKKPTMTVSAPSAVP 320 AND+ +L ++ +P Q P K+P +TVS PS P Sbjct: 354 ANDLQSSTELAQVPMQTTVPKQIPEEFKEPEITVSEPSLEP 394 >SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) Length = 1325 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 392 TDASSWNSQSGNHPQN 439 T+ SSWN +S N PQN Sbjct: 101 TEVSSWNFESWNEPQN 116 >SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4277 Score = 27.5 bits (58), Expect = 6.6 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 282 KPTMTVSAPSAVPTVNTNGNRGRYDTDPDDINSVFKIP 395 KP + P P G R D DPD IN VFK P Sbjct: 227 KPIKPIYVP---PHPKKPGKGDRKDYDPDSINYVFKPP 261 >SB_26858| Best HMM Match : ANF_receptor (HMM E-Value=2.4e-15) Length = 846 Score = 27.5 bits (58), Expect = 6.6 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 258 NQAPTTTKKPTMTVSAPSAVPTVNTNGNRGRYDTDPDDINSVFKIPTQAPGTV 416 +Q +T PT+T S PT++ +G +Y D +N+ IP Q P V Sbjct: 97 DQVNNSTVIPTVTSSCRIYTPTLHRSGFIRQYSI--DQVNNSTVIPHQLPALV 147 >SB_11854| Best HMM Match : Neuromodulin (HMM E-Value=7.3) Length = 531 Score = 27.5 bits (58), Expect = 6.6 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 264 APTTTKKPTMTVSAPSAVPTVNTNGNRG-RYDTDPD 368 APTTT PT T +AP+ T N + N Y T+ D Sbjct: 47 APTTTTAPT-TTTAPTTTTTPNNDYNTSDDYSTNND 81 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +3 Query: 264 APTTTKKPTMTVS-APSAVPTVNTNGNRGRYDTDPD 368 APTTT PT T + + PT T N Y+T D Sbjct: 41 APTTTTAPTTTTAPTTTTAPTTTTTPNND-YNTSDD 75 >SB_56875| Best HMM Match : LON (HMM E-Value=0) Length = 925 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = +3 Query: 231 EINSIFKIPNQAPTTTKKPTMTVSAPSAVPTVNTNGNRGRYDTDPD--DINSVFKI 392 +I + + P K T + P PT++ NGN G +P D+N + + Sbjct: 252 QITGVAEDPQHVEAAEKPDKDTPNTPPDEPTLDVNGNEGDGLVEPKRFDLNPILMV 307 >SB_49825| Best HMM Match : cobW (HMM E-Value=7.6) Length = 143 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 234 INSIFKIPNQAPTTTKKPTMTVSAPSAVPTVNTNGNRGRYDTD 362 IN + PNQA T + P V V+ + +R RYD D Sbjct: 93 INRVPPPPNQATLPTGEHGRIAPNPPPVHNVHKDASRRRYDQD 135 >SB_7865| Best HMM Match : Mucin (HMM E-Value=1.2) Length = 2527 Score = 27.1 bits (57), Expect = 8.7 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = +3 Query: 213 NDIDLEEINSIFKIPNQAPTTTKKPTMTVSAPSAVPTVNTNGNRGRYDTDPDDINSV 383 +D D ++I ++ T T T + A + + + NR R D DPDDI +V Sbjct: 1413 DDCDPDDIATVKTTVTMTATVT---TTVIRADNREDDRDRDDNRDRDDCDPDDIATV 1466 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,017,519 Number of Sequences: 59808 Number of extensions: 271531 Number of successful extensions: 876 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -