BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_M02 (586 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7902| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_23312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_56705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_7902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1020 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 492 GEILHTAQRIGVHRITHDRVLSFHFTMG 575 G +L A VHR+ H++VL F+ T+G Sbjct: 60 GLLLTEAMVYAVHRVNHEKVLPFNMTLG 87 >SB_23312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 444 YAIPPIYEVLPEYFNNGEILHTAQR 518 YA+P Y LP+Y NN E++ +R Sbjct: 9 YAVPVFYNALPQYLNN-ELVRIEKR 32 >SB_56705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +3 Query: 285 HQFEAVIMFNVLYSAKDYDTFYKTTVY--MKDRVNQDLYIYVLSTLHIHR 428 HQF I+F+ ++ Y TF + DR+ DL +Y +S I R Sbjct: 9 HQFPFNILFHKMFITHFYSTFIELAQLHDQHDRLELDLILYAISDALIIR 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,423,348 Number of Sequences: 59808 Number of extensions: 371574 Number of successful extensions: 827 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -