BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_L19 (492 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 28 0.69 01_05_0548 + 23149271-23149568,23149766-23149845,23150137-231502... 28 4.7 11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535,788... 27 8.2 03_05_0974 + 29324025-29324117,29325064-29325298,29325385-293257... 27 8.2 >03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 Length = 380 Score = 27.9 bits (59), Expect(2) = 0.69 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 417 NGISGNIGLNVDGNTERLVVESWLTNLEVVWVTS 316 NG + + G T+R+++ SWL+ LE+ + T+ Sbjct: 224 NGFTEAPETSNSGQTKRVLLSSWLSTLELAYTTA 257 Score = 21.4 bits (43), Expect(2) = 0.69 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 285 VSGIKLAIVKECD*FLNDNIIDFNADEMKFL 193 VSG ++A+ + L+ N++ + DEM L Sbjct: 298 VSGTRIALGDDGSIALSRNVVVLHVDEMLLL 328 >01_05_0548 + 23149271-23149568,23149766-23149845,23150137-23150223, 23150421-23150729,23150774-23150899,23151977-23152360, 23152603-23152608 Length = 429 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/78 (21%), Positives = 36/78 (46%), Gaps = 5/78 (6%) Frame = +1 Query: 244 LVTFFDYSQFDATNSVFLTK-----KEIKTSYPHNFKVRQPRLNHKPFSVTIDVXSDIAT 408 L F +S F ++++ + + ++KT ++ ++ PRL + S+ DV + + Sbjct: 64 LAAVFSFSSFTSSSNYVIRECLGSVLDLKTVATIDWSMKTPRLQYYTSSMVDDVFTRLGE 123 Query: 409 DAVIKIFLGPKYNDXGFP 462 D +K + Y G P Sbjct: 124 DIKVKPWAHTVYGKNGIP 141 >11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535, 7881648-7882304 Length = 451 Score = 27.1 bits (57), Expect = 8.2 Identities = 22/85 (25%), Positives = 36/85 (42%) Frame = +1 Query: 154 INAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQFDATNSVFLTKKEIKTSYPHN 333 +N F+ L PYP ++HF+ V+ + S + TNS F + P + Sbjct: 252 VNEFQTNLVPYP--RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRH 309 Query: 334 FKVRQPRLNHKPFSVTIDVXSDIAT 408 K L ++ V DV + +AT Sbjct: 310 GKYMACCLMYRGDVVPKDVNAAVAT 334 >03_05_0974 + 29324025-29324117,29325064-29325298,29325385-29325755, 29325864-29326520 Length = 451 Score = 27.1 bits (57), Expect = 8.2 Identities = 22/85 (25%), Positives = 36/85 (42%) Frame = +1 Query: 154 INAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQFDATNSVFLTKKEIKTSYPHN 333 +N F+ L PYP ++HF+ V+ + S + TNS F + P + Sbjct: 252 VNEFQTNLVPYP--RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRH 309 Query: 334 FKVRQPRLNHKPFSVTIDVXSDIAT 408 K L ++ V DV + +AT Sbjct: 310 GKYMACCLMYRGDVVPKDVNAAVAT 334 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,280,805 Number of Sequences: 37544 Number of extensions: 224324 Number of successful extensions: 517 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1023611560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -