BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_L07 (480 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.48 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 4.5 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 4.5 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 5.9 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 5.9 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.8 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 7.8 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 24.6 bits (51), Expect = 0.48 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 339 PARMATPVVSVPGSSLT 389 PA +A+P+V PGSS T Sbjct: 92 PAPLASPLVQEPGSSTT 108 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 296 VDPRGSASFSLHGRHTRNACQHRKVHH 216 +DPR ++ + G T + CQ V H Sbjct: 22 LDPRLNSKIQVSGASTTDECQVTPVIH 48 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -3 Query: 463 LNRKILDPGRIQHNTYPMSHGLRWQVRLEPG 371 L ++ PG+ Y H QV L PG Sbjct: 97 LKHAVVHPGQSPAEKYDQQHLYHPQVLLSPG 127 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.0 bits (42), Expect = 5.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 384 DLNLARTPPELPCGR 340 DL++ TPP L C + Sbjct: 54 DLDVTGTPPPLDCSK 68 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 5.9 Identities = 5/6 (83%), Positives = 6/6 (100%) Frame = -2 Query: 374 WHGHHR 357 WHGHH+ Sbjct: 135 WHGHHQ 140 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 295 WTPGDRRPFLCTVDIHA 245 +TP D P LCT I+A Sbjct: 541 FTPEDINPSLCTHIIYA 557 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 20.6 bits (41), Expect = 7.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 288 PGIGVLFFAR*TY 250 PG+GV ++AR Y Sbjct: 279 PGVGVFWYARLLY 291 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,994 Number of Sequences: 336 Number of extensions: 2817 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -