BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_L07 (480 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 25 0.56 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 25 0.56 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.3 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 3.9 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 6.9 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 6.9 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 24.6 bits (51), Expect = 0.56 Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 91 FTHHLGWFCG-SCRGCFSGFLFW 26 ++H LGW CG S C G++ + Sbjct: 527 WSHVLGWLCGLSSMLCIPGYMIY 549 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.6 bits (51), Expect = 0.56 Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 91 FTHHLGWFCG-SCRGCFSGFLFW 26 ++H LGW CG S C G++ + Sbjct: 580 WSHVLGWLCGLSSMLCIPGYMIY 602 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 1.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 381 LNLARTPPELPCGRVTLPQ 325 L L PP CG V++PQ Sbjct: 1263 LMLQHAPPAYSCGTVSVPQ 1281 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 3.9 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -2 Query: 287 RGSASFSLHGRHTRNACQHRKVHHCDPLYLQSLTKLYF 174 RGS+ HG HT HH QSL L++ Sbjct: 330 RGSSPHHQHGNHTMGPTM-GPPHHHHHHQTQSLQHLHY 366 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.0 bits (42), Expect = 6.9 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -3 Query: 295 WTPGDRR--PFLCTVDIHATLASIEK 224 W G +R CTV +H T+ S +K Sbjct: 93 WVAGAQRGNEQRCTVTMHGTVQSYDK 118 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 6.9 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -2 Query: 353 CHAGGSPCPRL 321 CH G P PR+ Sbjct: 423 CHVAGEPLPRV 433 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,809 Number of Sequences: 438 Number of extensions: 3096 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -