BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_L06 (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 23 1.3 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.9 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 5.2 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 6.8 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 23.4 bits (48), Expect = 1.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 304 NGKTYANKCSLECTQKIIPSL 366 NG+ NKC C ++ PS+ Sbjct: 51 NGEVAVNKCEGSCKSQVQPSV 71 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.0 bits (47), Expect = 1.7 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 91 YSVTALPPPLCICGKIYSPVCGSDGKTYENPCEFDCEKDKTH 216 Y ++A P P +IY PV TY P ++ + TH Sbjct: 334 YQISAQPTPSQSPNQIYQPVTNLTNLTY--PSYYNQDVSCTH 373 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 3.9 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +2 Query: 179 TRVNLTAKKTRHTAI*QS*KTPHARWASPATVPWNMPPSVALTEKLTPT 325 T V+ A T H + K P W+S T PW + T PT Sbjct: 1019 TGVDTGASSTEHMHPDWTTK-PSTWWSSTTTSPWWTTTTTRRTTTTRPT 1066 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.4 bits (43), Expect = 5.2 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +1 Query: 253 VGIPCYCTLEYAPVCGSNGKTYANKCSL 336 + + CY T ++P+ + + CSL Sbjct: 143 LSVTCYVTYAWSPIDHTESNIINDMCSL 170 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 292 VCGSNGKTYANKCSLECTQKII 357 V G N YA+ +E +QK++ Sbjct: 220 VTGQNAPLYASSIDVEGSQKLL 241 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,079 Number of Sequences: 336 Number of extensions: 3148 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -