BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_L02 (613 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 25 1.9 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 25 2.5 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 4.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 7.8 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/33 (33%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +2 Query: 317 PNRTIRMARREKYKRRQPLQH-QTNNSSQSRRK 412 P R + +++ +RRQ QH Q +N++Q++R+ Sbjct: 82 PQRQAVVGTQQQQQRRQQQQHQQRSNATQAQRR 114 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 24.6 bits (51), Expect = 2.5 Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -2 Query: 153 PLCTPLIGWRSTAPDTTS--AWG 91 P+ L+GWR +PD ++ WG Sbjct: 7 PIVKRLLGWRKVSPDDSAEGKWG 29 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 141 PLIGWRSTAPDTTSAWGSFTTTSPT 67 P I W + P ++ A+ S T PT Sbjct: 230 PSISWSTADPSSSPAYSSITHYEPT 254 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.0 bits (47), Expect = 7.8 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +3 Query: 297 PAGPGRRPTEPSEWPGGRSTRGASR 371 PA R T P+ WP R T R Sbjct: 275 PARRRSRSTRPTSWPRSRPTSKPKR 299 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 454,749 Number of Sequences: 2352 Number of extensions: 8187 Number of successful extensions: 24 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -