BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_L02 (613 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 3.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.5 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 517 FYQCRTSTSLINSYCPFQLI 576 FY+ T +L+N+Y F+L+ Sbjct: 48 FYRQDTKNNLLNAYVRFKLV 67 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = +1 Query: 472 GWLSLRHVDFFVVFHFYQCRTSTSLINSYCPFQLINYKLGN 594 G L + ++F H Y+CRT L + N ++ + Sbjct: 191 GELLVHSLEFSDQIHGYRCRTMHRLTRQVVVSSVANVRIAD 231 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = +1 Query: 472 GWLSLRHVDFFVVFHFYQCRTSTSLINSYCPFQLINYKLGN 594 G L + ++F H Y+CRT L + N ++ + Sbjct: 191 GELLVHSLEFSDQIHGYRCRTMHRLTRQVVVSSVANVRIAD 231 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,506 Number of Sequences: 438 Number of extensions: 2361 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -