BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K23 (575 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 2.2 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 2.2 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.9 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.9 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 21 6.6 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 21 6.6 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +1 Query: 148 KTKKMYFLSGHTNSVSTV 201 K +K+Y SGH +++++V Sbjct: 247 KKRKIYLFSGHESNIASV 264 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +1 Query: 148 KTKKMYFLSGHTNSVSTV 201 K +K+Y SGH +++++V Sbjct: 262 KKRKIYLFSGHESNIASV 279 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 370 SYSARPMRTLELRPAPCVTHGCRSEPSS*SPKFSR 266 S S + ++ELR PC+ +SE + S + SR Sbjct: 612 SASEESVHSMELRTLPCLLPRPKSENNFASQELSR 646 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 370 SYSARPMRTLELRPAPCVTHGCRSEPSS*SPKFSR 266 S S + ++ELR PC+ +SE + S + SR Sbjct: 580 SASEESVHSMELRTLPCLLPRPKSENNFASQELSR 614 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 146 GRRRKCIFSVVIQTACP 196 GRR K + +V++ ACP Sbjct: 65 GRRLKSLAPLVLRGACP 81 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 146 GRRRKCIFSVVIQTACP 196 GRR K + +V++ ACP Sbjct: 65 GRRLKSLAPLVLRGACP 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,605 Number of Sequences: 438 Number of extensions: 3653 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -