BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K22 (570 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 26 4.5 SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 26 4.5 SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr ... 26 4.5 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 25 5.9 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.8 bits (54), Expect = 4.5 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = +3 Query: 99 FFSQPSNGP----SGNYEPISTGPAFVDF 173 F + P+N P SG+Y PI P F F Sbjct: 1560 FVTPPTNSPYAEVSGDYNPIHVSPTFAAF 1588 >SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 25.8 bits (54), Expect = 4.5 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 129 GNYEPI--STGPAFVDFNHPNYPPKRYDNPLAR 221 G+Y P ST P + +P+YPP Y AR Sbjct: 117 GSYPPTQPSTQPLPQSYGYPSYPPAGYRGGSAR 149 >SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 962 Score = 25.8 bits (54), Expect = 4.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 464 DGIDKLDIEFGTRLVSSFFFFFLICYRKENF 372 DGIDK+D++ L+ FF F + + +F Sbjct: 371 DGIDKIDVQNFILLILKFFGFAISASDRRSF 401 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 25.4 bits (53), Expect = 5.9 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 105 SQPSNGPSGNYEPISTGPAFVDFNHPNYPP 194 S P N P P+S PA + P PP Sbjct: 265 SSPPNSPPRPIAPVSMNPAINSTSKPPLPP 294 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,854,839 Number of Sequences: 5004 Number of extensions: 32550 Number of successful extensions: 81 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 242064240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -