BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K20 (619 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 24 1.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.4 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 3.2 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 4.2 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 4.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.3 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 9.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 9.6 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 9.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.6 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 62 INYWIQNGAPTHKLVLGIST--TGRTWKLDSDSEISGV 169 +++WI A + ++ LGI+T T T LDS +++ V Sbjct: 264 VSFWIHREATSDRVGLGITTVLTLSTISLDSRTDLPKV 301 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 2.4 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -1 Query: 379 NPEATFTIIIRKAEGIGPKTFARIVDLTKMRTLSV 275 +P T TII + GP T R+ DL + TL V Sbjct: 962 DPSDTVTIITAEEAPSGPPTSIRVDDLDQ-HTLKV 995 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.6 bits (46), Expect = 3.2 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +2 Query: 62 INYWIQNGAPTHKLVLGIST 121 +++WI + A + ++ LGI+T Sbjct: 261 VSFWINHEATSARVALGITT 280 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = +3 Query: 21 HRRTAILYKTPT 56 H++TAI ++TPT Sbjct: 279 HKQTAIAFRTPT 290 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = +3 Query: 21 HRRTAILYKTPT 56 H++TAI ++TPT Sbjct: 279 HKQTAIAFRTPT 290 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 369 ASGFLTKILTRPETKLVT*KQRTLAVCPS 455 ++ F +K++TRP+T + +AV P+ Sbjct: 1136 STSFDSKVMTRPDTDSENWTPKMMAVEPT 1164 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 9.6 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +2 Query: 62 INYWIQNGAPTHKLVLGIST 121 +++W+ A ++ LG++T Sbjct: 240 VSFWLNRNATPARVALGVTT 259 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 9.6 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +2 Query: 62 INYWIQNGAPTHKLVLGIST 121 +++W+ A ++ LG++T Sbjct: 240 VSFWLNRNATPARVALGVTT 259 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.0 bits (42), Expect = 9.6 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +2 Query: 62 INYWIQNGAPTHKLVLGIST 121 +++W+ A ++ LG++T Sbjct: 179 VSFWLNRNATPARVALGVTT 198 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = +2 Query: 140 LDSDSEISGVPPIHADEGGEAGPYTKVQGL 229 + D + G+ P+H G GP +G+ Sbjct: 53 IPGDIVLGGLFPVHEKGGASCGPNVYNRGV 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,473 Number of Sequences: 438 Number of extensions: 4469 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -