BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K19 (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) 219 3e-61 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 43 2e-04 SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_27355| Best HMM Match : ABC_tran (HMM E-Value=1.1e-37) 40 0.001 SB_52373| Best HMM Match : ABC_tran (HMM E-Value=3.4e-11) 36 0.025 SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) 36 0.025 SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_44672| Best HMM Match : ABC_tran (HMM E-Value=4.2039e-44) 35 0.043 SB_37511| Best HMM Match : ABC_tran (HMM E-Value=0) 35 0.043 SB_36627| Best HMM Match : ABC_tran (HMM E-Value=5.4e-06) 35 0.043 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 34 0.075 SB_56902| Best HMM Match : NACHT (HMM E-Value=1.5e-10) 33 0.17 SB_26155| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_58724| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) 32 0.30 SB_53189| Best HMM Match : ABC_tran (HMM E-Value=0.021) 32 0.40 SB_20094| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_3746| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_26620| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_22546| Best HMM Match : ABC_tran (HMM E-Value=0) 31 0.53 SB_24754| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) 31 0.53 SB_14067| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) 31 0.70 SB_1013| Best HMM Match : Peptidase_M1 (HMM E-Value=0.041) 30 1.2 SB_59051| Best HMM Match : ABC_tran (HMM E-Value=2.4e-41) 30 1.2 SB_37300| Best HMM Match : MMR_HSR1 (HMM E-Value=0.061) 30 1.6 SB_38838| Best HMM Match : ABC_tran (HMM E-Value=0.24) 29 2.8 SB_25957| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.7 SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.7 SB_54124| Best HMM Match : AAA (HMM E-Value=7.8e-08) 29 3.7 SB_40812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_34997| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_45235| Best HMM Match : CBM_20 (HMM E-Value=0.91) 28 6.5 SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_30948| Best HMM Match : NACHT (HMM E-Value=0.0023) 28 6.5 SB_30636| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_51198| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_42540| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_32046| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_41103| Best HMM Match : p450 (HMM E-Value=0) 27 8.6 SB_34413| Best HMM Match : Myosin_head (HMM E-Value=0) 27 8.6 SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 27 8.6 SB_55554| Best HMM Match : AAA (HMM E-Value=0.022) 27 8.6 SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 27 8.6 SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_33973| Best HMM Match : ABC_tran (HMM E-Value=0) 27 8.6 SB_23377| Best HMM Match : WH1 (HMM E-Value=2.8) 27 8.6 >SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 219 bits (535), Expect(2) = 3e-61 Identities = 107/155 (69%), Positives = 125/155 (80%) Frame = +1 Query: 130 DKFIIVVEHDLSVLDYLSDFICCLYGVPGAYGVVTMPFSVREGINIFLDGFVPTENMRFR 309 D +IIVVEHDLSVLDYLSDFICCLYG PGAYGVVT+PFSVREGINIFLDGFVPTEN+RFR Sbjct: 241 DVYIIVVEHDLSVLDYLSDFICCLYGTPGAYGVVTLPFSVREGINIFLDGFVPTENLRFR 300 Query: 310 TESLVFKVAESATEEEIKRMNHYEYPEMSKHMGDFDLRVMPGEFSDSEILVLLGENGTGK 489 SLVFKV+E+A + I+ +P DF + + GEF+DSEI+V+LGENGTGK Sbjct: 301 DTSLVFKVSETADKVSIEPSVIGVWPGGLNE--DFQMNIDAGEFTDSEIIVMLGENGTGK 358 Query: 490 TTFIRMLAGNLEPDDGSGQLPQLHISYKPQKISPK 594 TTFIRMLAG L PD+ ++P L++SYKPQKISPK Sbjct: 359 TTFIRMLAGKLSPDNDE-EVPMLNVSYKPQKISPK 392 Score = 43.6 bits (98), Expect = 1e-04 Identities = 33/111 (29%), Positives = 53/111 (47%), Gaps = 5/111 (4%) Frame = +1 Query: 73 LDVKQRLNAARTI-RSLINPDKFIIVVEHDLSVLDYLSDFICCLYGVPGAYGVVTMPFSV 249 L +QRL AA+ I R +++ K VVEHD + YL+D + G+P + P ++ Sbjct: 457 LSGEQRLVAAKVIKRFILHAKKTGFVVEHDFIMATYLADRVIVFEGIPSVKTLANTPQTL 516 Query: 250 REGINIFLDGFVPTENMRFRTESLVFK----VAESATEEEIKRMNHYEYPE 390 G+N FL+ + FR + F+ S + E KR +Y + E Sbjct: 517 LTGMNRFLESL----EITFRRDPSNFRPRINKLHSVKDTEQKRSGNYFFLE 563 Score = 34.7 bits (76), Expect = 0.057 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 451 EILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLP 552 E+L L+G NG GK+T +++LAG +P+ G P Sbjct: 112 EVLGLVGTNGIGKSTALKILAGKQKPNLGRHDTP 145 Score = 33.9 bits (74), Expect(2) = 3e-61 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +1 Query: 1 QRFACAMVCIQNADIFM 51 QRFACA+VCIQ+AD+++ Sbjct: 228 QRFACAVVCIQSADVYI 244 >SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1636 Score = 43.2 bits (97), Expect = 2e-04 Identities = 37/137 (27%), Positives = 61/137 (44%) Frame = +1 Query: 130 DKFIIVVEHDLSVLDYLSDFICCLYGVPGAYGVVTMPFSVREGINIFLDGFVPTENMRFR 309 D FI+V++ L +L LS + LY V V +++G N F +G +P + F Sbjct: 239 DPFILVIQQTLPLLLMLSLVVTALYIVKDI--VHEKERKLKDGDNDFHNGHLPNASTEF- 295 Query: 310 TESLVFKVAESATEEEIKRMNHYEYPEMSKHMGDFDLRVMPGEFSDSEILVLLGENGTGK 489 E ++ +K++ + E K + + + + +I LLG NG GK Sbjct: 296 LEKEPSRLHAGVVINSLKKV----FSENGKKVAVDGVSL---NMYEGQITALLGHNGAGK 348 Query: 490 TTFIRMLAGNLEPDDGS 540 TT + ML G P G+ Sbjct: 349 TTLMSMLTGLFPPTSGN 365 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 Query: 451 EILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLPQLHI 564 E LLG NG GKTT RML G+ G+ + I Sbjct: 1282 ECFGLLGINGAGKTTTFRMLTGDETMTSGTATVDNYDI 1319 >SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 958 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +1 Query: 418 LRVMPGEFSDSEILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLPQLHISYKPQK 582 L+ + G+ E+L L+G +G+GKTT + +LAG + D G + H++ K +K Sbjct: 25 LKTINGKVRPGEMLALMGPSGSGKTTLLNVLAGRMAKDAGDVLINGKHMNKKLKK 79 >SB_27355| Best HMM Match : ABC_tran (HMM E-Value=1.1e-37) Length = 226 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +1 Query: 451 EILVLLGENGTGKTTFIRMLAGNLEPDDGS 540 EI+ L+GENG GKTT +R L G L P G+ Sbjct: 2 EIIGLVGENGNGKTTLLRSLCGELNPTSGT 31 >SB_52373| Best HMM Match : ABC_tran (HMM E-Value=3.4e-11) Length = 406 Score = 35.9 bits (79), Expect = 0.025 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 4 RFACAMVCIQNADIFMFDEPSSYLDVKQRLNA-ARTIRSLINPDKFIIVVEHDLSVLD 174 R + A +ADI++ D+P S LD K R R I L+ DK I+V HDL ++ Sbjct: 204 RVSLARALYLDADIYVLDDPLSALDFKVRRRVFQRCICELLR-DKLCILVTHDLGCIE 260 >SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1702 Score = 35.9 bits (79), Expect = 0.025 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 4 RFACAMVCIQNADIFMFDEPSSYLDVKQRLNA-ARTIRSLINPDKFIIVVEHDLSVLD 174 R + A +ADI++ D+P S LD K R R I L+ DK I+V HDL ++ Sbjct: 912 RVSLARALYLDADIYVLDDPLSALDFKVRRRVFQRCICELLR-DKLCILVTHDLGCIE 968 >SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 683 Score = 35.5 bits (78), Expect = 0.033 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = +1 Query: 457 LVLLGENGTGKTTFIRMLAGNLEPDDG 537 + ++G+NG+GKTT +++L G LEP G Sbjct: 367 IAVVGDNGSGKTTLLKILLGELEPVKG 393 >SB_44672| Best HMM Match : ABC_tran (HMM E-Value=4.2039e-44) Length = 945 Score = 35.1 bits (77), Expect = 0.043 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 445 DSEILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLPQLHISYKPQKI 585 + +I+ LG NG GKTT + +L G P G+G + I + KI Sbjct: 527 EGQIMSFLGHNGAGKTTTMSILTGLFPPTAGTGYIYGHDIRFDMDKI 573 >SB_37511| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 884 Score = 35.1 bits (77), Expect = 0.043 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 445 DSEILVLLGENGTGKTTFIRMLAGNLEPDDGS 540 + +I LLG NG GK+T I L G ++P G+ Sbjct: 521 EGQITALLGHNGAGKSTLIGALTGMIQPSSGT 552 >SB_36627| Best HMM Match : ABC_tran (HMM E-Value=5.4e-06) Length = 240 Score = 35.1 bits (77), Expect = 0.043 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +1 Query: 406 GDFDLRVMPGEFSDSEILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLPQLHIS-YKPQK 582 G LR + + E+ LLG NG GKTT ++ L G + +G+ Q I+ +KP + Sbjct: 95 GSHILRGLSFDVKVGEVTCLLGRNGVGKTTLLKCLMGLIPAKEGAVQWEGQPITGFKPHQ 154 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/62 (24%), Positives = 32/62 (51%) Frame = +1 Query: 19 MVCIQNADIFMFDEPSSYLDVKQRLNAARTIRSLINPDKFIIVVEHDLSVLDYLSDFICC 198 M+ +Q+ + + DEP + + + A +SL ++VVEHD+ + ++D + Sbjct: 1 MLLVQDPQLLLLDEPVAGMTDAETEFTAELFKSLARKHS-LMVVEHDMGFVGSIADHVTV 59 Query: 199 LY 204 L+ Sbjct: 60 LH 61 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 34.3 bits (75), Expect = 0.075 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 451 EILVLLGENGTGKTTFIRMLAGNLEPDDGSGQL 549 +I LLG NG GKTT + +L G P GS + Sbjct: 228 QITALLGHNGAGKTTTMSILTGLFTPTSGSAMI 260 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 451 EILVLLGENGTGKTTFIRMLAGNLEPDDGSGQL 549 E LLG NG GKTT ML G+ +G+ L Sbjct: 1280 ECFGLLGVNGAGKTTTFSMLTGDQSISEGTAYL 1312 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/67 (23%), Positives = 30/67 (44%) Frame = +1 Query: 1 QRFACAMVCIQNADIFMFDEPSSYLDVKQRLNAARTIRSLINPDKFIIVVEHDLSVLDYL 180 ++ CA+ + ++ DEP+S +D R A + K +I+ H + D+L Sbjct: 339 RKLNCAIALVGGSETVFLDEPTSGMDPYAR-RATWDLLLKHKAGKTVILTTHFMDEADFL 397 Query: 181 SDFICCL 201 D I + Sbjct: 398 GDRIAIM 404 >SB_56902| Best HMM Match : NACHT (HMM E-Value=1.5e-10) Length = 1037 Score = 33.1 bits (72), Expect = 0.17 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 4/83 (4%) Frame = +1 Query: 328 KVAESATEEE----IKRMNHYEYPEMSKHMGDFDLRVMPGEFSDSEILVLLGENGTGKTT 495 K A + TEE+ ++ +H E PE+ M D P + S ++L GE+G GKTT Sbjct: 94 KDAATITEEDKAASMRAGDHQERPEIKVPMYDIFTASEPSKTVRS--VLLEGESGVGKTT 151 Query: 496 FIRMLAGNLEPDDGSGQLPQLHI 564 F + LA + PQ+ I Sbjct: 152 FCQKLAYDWAKGALPKSFPQVEI 174 >SB_26155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 815 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 418 LRVMPGEFSDSEILVLLGENGTGKTTFIRMLAG 516 ++ + G+F E++ +LG +G GK+T I +LAG Sbjct: 142 IKDVSGKFKSGELVGVLGPSGAGKSTLINVLAG 174 >SB_58724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 32.3 bits (70), Expect = 0.30 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 397 KHMGDFDLRVMPGEFSDSEILVLLGENGTGKTTFIRMLAG 516 K G L+ + GE E+ ++G +G GKTT + L+G Sbjct: 147 KQTGKQVLQSVTGEIRAGEVTAIMGPSGAGKTTLLNTLSG 186 >SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) Length = 1301 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +1 Query: 373 HYEYPEMS--KHMGDFDLRVMPGEFSDSEILVLLGENGTGKTTFIRMLAGNLEPDDGS 540 H+ YP + K + L V G+ + L+GE+G GK+T I+++ +P++GS Sbjct: 658 HFYYPSRNEVKVLNGLSLTVRSGQ-----TVALVGESGCGKSTVIKLIQRFYDPENGS 710 >SB_53189| Best HMM Match : ABC_tran (HMM E-Value=0.021) Length = 127 Score = 31.9 bits (69), Expect = 0.40 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 433 GEFSDSEILVLLGENGTGKTTFIRMLAG 516 G+ + E+ ++G +G GKTTF+ L+G Sbjct: 12 GKINSGEVTAVMGPSGAGKTTFLNTLSG 39 >SB_20094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 31.9 bits (69), Expect = 0.40 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +1 Query: 451 EILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLPQLHISYKPQK 582 +I ++G +G+GKTT +++L EP +G L + +S QK Sbjct: 252 KITAIVGTSGSGKTTLMKLLLKFYEPSEGDVLLGKSSLSNLSQK 295 >SB_3746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 31.9 bits (69), Expect = 0.40 Identities = 17/69 (24%), Positives = 40/69 (57%) Frame = +1 Query: 373 HYEYPEMSKHMGDFDLRVMPGEFSDSEILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLP 552 H+ ++S + D ++ +F++++++++ G G+GK++ + L G L P +GS + Sbjct: 80 HWNGTDVSPVLSDINM-----DFNENKLVLVTGPVGSGKSSLLLTLLGELLPSEGSVK-T 133 Query: 553 QLHISYKPQ 579 + + Y PQ Sbjct: 134 RGEVVYVPQ 142 >SB_26620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 433 Score = 31.5 bits (68), Expect = 0.53 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 433 GEFSDSEILVLLGENGTGKTTFIRMLAG 516 G+ E+ ++G +G GKTTF+ L+G Sbjct: 336 GKIKSGEVTAVMGPSGAGKTTFLNTLSG 363 >SB_22546| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 844 Score = 31.5 bits (68), Expect = 0.53 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 418 LRVMPGEFSDSEILVLLGENGTGKTTFIRMLAGNLEPDDG 537 LR + E + + L L+G +G GK+T + +L +P+DG Sbjct: 685 LRGLSLEVNQGQTLALVGPSGCGKSTTVSLLERFYDPEDG 724 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = +1 Query: 373 HYEYPEMSKHMGDFDLRVMPG---EFSDSEILVLLGENGTGKTTFIRMLAGNLEPDDGS 540 H++YP D++V+ G + + L+GE+G GK+T I+++ +P +G+ Sbjct: 123 HFQYPSRP------DVKVLKGLHLTIRSGQTVALVGESGCGKSTLIKLVQRFYDPAEGT 175 >SB_24754| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) Length = 781 Score = 31.5 bits (68), Expect = 0.53 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 433 GEFSDSEILVLLGENGTGKTTFIRMLAG 516 G+ E+ ++G +G GKTTF+ L+G Sbjct: 218 GKIKSGEVTAVMGPSGAGKTTFLNTLSG 245 >SB_14067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.53 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 457 LVLLGENGTGKTTFIRMLAGNLEPDDG 537 + L+G NG GK+T ++++ G L P +G Sbjct: 89 VALVGPNGAGKSTLLKLIEGLLSPTEG 115 >SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) Length = 562 Score = 31.1 bits (67), Expect = 0.70 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 451 EILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLPQLHISYKPQKI 585 E+ LLG NG GKTT + M+ + GS + + + K+ Sbjct: 320 EVFGLLGPNGAGKTTTLNMMTAGIPASRGSVSVAGYDLQTETHKV 364 >SB_1013| Best HMM Match : Peptidase_M1 (HMM E-Value=0.041) Length = 999 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 509 NILMNVVF--PVPFSPSKTKISESENSPGITRKSKSPICLDI 390 N LM +V PVP+ T S+N P TRKS SP+C + Sbjct: 721 NFLMEIVEKDPVPYIRHHTLRVLSDNPP-FTRKSDSPLCTQV 761 >SB_59051| Best HMM Match : ABC_tran (HMM E-Value=2.4e-41) Length = 474 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 1 QRFACAMVCIQNADIFMFDEPSSYLDVKQRLNAARTIRSLINPDKFIIVVEHDLS-VLDY 177 Q A A + N I + DE +S +D K IRS + II V H LS ++DY Sbjct: 208 QLVALARALVYNTKILVLDEATSVVDYKTDRLVQEIIRSKFK-NSTIITVPHRLSTIIDY 266 >SB_37300| Best HMM Match : MMR_HSR1 (HMM E-Value=0.061) Length = 152 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +1 Query: 433 GEFSDSEILVLLGENGTGKTTFIRMLA 513 G+ + E++ ++G +G+GKTT I +LA Sbjct: 43 GKVNPGELVAVMGASGSGKTTLINVLA 69 >SB_38838| Best HMM Match : ABC_tran (HMM E-Value=0.24) Length = 169 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 412 FDLRVMPGEFSDSEILVLLGENGTGKTTFIRML 510 F R+ PGE + L+G +G+GKTTFI+++ Sbjct: 86 FSARIAPGER-----VGLVGHSGSGKTTFIKLI 113 >SB_25957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 29.1 bits (62), Expect = 2.8 Identities = 22/80 (27%), Positives = 31/80 (38%) Frame = +1 Query: 289 TENMRFRTESLVFKVAESATEEEIKRMNHYEYPEMSKHMGDFDLRVMPGEFSDSEILVLL 468 T N+ E F E+ +++K +H E E G + SD E VLL Sbjct: 97 TNNITKEQEVFAFGFTEAL--KKLKEEDHLEIRESDNQTGPDNDGEASDSSSDDESTVLL 154 Query: 469 GENGTGKTTFIRMLAGNLEP 528 E K TFI + +P Sbjct: 155 DEENDTKITFISYAFNSKQP 174 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +1 Query: 4 RFACAMVCIQNADIFMFDEPSSYLDVKQRLNAARTIRSLINPDKFIIVVEHDLSVL 171 R A A + + N D+ + DEP++ LD++ A I +I+V HD ++ Sbjct: 452 RVAFADMALSNPDVVILDEPTNNLDIESIDALAAAINEFTGG---VILVSHDARLI 504 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +1 Query: 4 RFACAMVCIQNADIFMFDEPSSYLDVKQ-RLNAARTIRSLINPDKFIIVVEHDLSVLDYL 180 R A +ADI + D+P S +D R + L+ D+ ++V H L L Sbjct: 161 RINLARAVYYDADIVLLDDPLSAVDTHVGRQLFDECVYGLLK-DRICVLVTHQLQYLKGA 219 Query: 181 SDFIC 195 +D IC Sbjct: 220 TDIIC 224 >SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1310 Score = 28.7 bits (61), Expect = 3.7 Identities = 28/122 (22%), Positives = 46/122 (37%), Gaps = 4/122 (3%) Frame = +1 Query: 4 RFACAMVCIQNADIFMFDEPSSYLDVKQRLNAARTIRSLINPDKFIIVVEHDLSVLDYLS 183 R + A +ADI++ D+P S +D K + + +K I+V H L L + Sbjct: 589 RVSLARAVYADADIYLLDDPLSAVDAKVGSHLFKECICGALTNKVRILVTHQLQYLKHAD 648 Query: 184 DFICCLYGVPGAYGVVTMPFSVREGINI----FLDGFVPTENMRFRTESLVFKVAESATE 351 I G G GI++ +DG P E + + + A + Sbjct: 649 SIIVLSDGKIAQKGTFQDMDVSHIGIDVSKDSVIDGAAPVEGQQGHHDLIDGAPAVDMAD 708 Query: 352 EE 357 EE Sbjct: 709 EE 710 >SB_54124| Best HMM Match : AAA (HMM E-Value=7.8e-08) Length = 251 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 457 LVLLGENGTGKTTFIRMLAGNL 522 ++ +G GTGKTT RM+AG L Sbjct: 16 VMFVGNPGTGKTTMARMMAGIL 37 >SB_40812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1168 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = +1 Query: 334 AESATEEEIKRMNHYEYPEMSKHMGDFDLRVMPGEFSDSEILVLLGENGTGKTT 495 AE AT E++R + + + + +M S++ +++L GE G+GKTT Sbjct: 273 AEPATFIEVEREPEIQAARLQLPILAEEQAIMEA-ISENNVVILCGETGSGKTT 325 >SB_34997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 451 EILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLPQLHISYKPQK 582 E+ ++ G G+GK+T + + G L +GS L + + Y PQK Sbjct: 503 ELTLINGPGGSGKSTLLLAVLGELPVTEGS-ILTEGRMVYVPQK 545 >SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 442 SDSEILVLLGENGTGKTTFIRMLA 513 SD ++VL GE+G GKT+ + +A Sbjct: 442 SDDRVVVLYGESGCGKTSLMAKIA 465 >SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 485 PVPFSPSKTKISESENSPGITRKSKSPICLDI 390 PV P + K E E P + S SP CLD+ Sbjct: 388 PVDQPPPRPKKPEREEVPEMNSSSGSPSCLDV 419 >SB_45235| Best HMM Match : CBM_20 (HMM E-Value=0.91) Length = 817 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -3 Query: 326 NTKDSVLNRIFSVGTNPSRNILIPSLTEKGIVTTP*APGTP 204 N ++NR SV TN S+N L + TTP A P Sbjct: 589 NDTTRIMNRQLSVDTNLSKNALASVAVTLRVTTTPAALNAP 629 >SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1250 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +1 Query: 4 RFACAMVCIQNADIFMFDEPSSYLDVKQRLNAARTIRSLINPDKFIIVVEHDLSVL 171 R A +ADI++ D+P S +D K + I DK ++V H L L Sbjct: 545 RIGLARALYADADIYLLDDPLSSVDAKVGRHIFDECVCGILKDKTRVLVTHQLQYL 600 >SB_30948| Best HMM Match : NACHT (HMM E-Value=0.0023) Length = 180 Score = 27.9 bits (59), Expect = 6.5 Identities = 19/91 (20%), Positives = 44/91 (48%), Gaps = 7/91 (7%) Frame = +1 Query: 313 ESLVFKVAESATEEEIKRMNHYEYPEMSKHMGDFDLR-----VMPGEFSDSEILVLLGEN 477 E + + E+ E + + + P++ + D +++ V+ G+ ++ ++L G++ Sbjct: 17 EMALIEPLENLEEHDFSLDSMFTEPKIVRKDTDLEVKMNNMFVVDGKVKEACKVLLEGDS 76 Query: 478 GTGKTTFIRMLAGNLEPD--DGSGQLPQLHI 564 G GKTT + LA + GS P++ + Sbjct: 77 GAGKTTLTKKLASDWAKGVLSGSSTFPEVEL 107 >SB_30636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/35 (28%), Positives = 24/35 (68%) Frame = +1 Query: 436 EFSDSEILVLLGENGTGKTTFIRMLAGNLEPDDGS 540 + + E++ L+G +G+GK+T +R + +P++G+ Sbjct: 43 DVAPGEVVCLIGPSGSGKSTLLRCVNLLEQPNEGT 77 >SB_51198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1627 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 529 DDGSGQLPQLHISYKPQKISP 591 DDG G L H+S +P K SP Sbjct: 743 DDGKGGLKNRHVSAQPYKFSP 763 >SB_42540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1471 Score = 27.9 bits (59), Expect = 6.5 Identities = 19/91 (20%), Positives = 44/91 (48%), Gaps = 7/91 (7%) Frame = +1 Query: 313 ESLVFKVAESATEEEIKRMNHYEYPEMSKHMGDFDLR-----VMPGEFSDSEILVLLGEN 477 E + + E+ E + + + P++ + D +++ V+ G+ ++ ++L G++ Sbjct: 566 EMALIEPLENLEEHDFSLDSMFTEPKIVRKDTDLEVKMNNMFVVDGKVKEACKVLLEGDS 625 Query: 478 GTGKTTFIRMLAGNLEPD--DGSGQLPQLHI 564 G GKTT + LA + GS P++ + Sbjct: 626 GAGKTTLTKKLASDWAKGVLSGSSTFPEVEL 656 >SB_32046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1570 Score = 27.9 bits (59), Expect = 6.5 Identities = 20/91 (21%), Positives = 43/91 (47%), Gaps = 7/91 (7%) Frame = +1 Query: 313 ESLVFKVAESATEEEIKRMNHYEYPEMSKHMGDFDLR-----VMPGEFSDSEILVLLGEN 477 E + + E+ E + + + P++ K D +++ V+ G+ + ++L G++ Sbjct: 707 EMALIEPLENLEEHDFSLDSMFTEPKIVKKDTDLEVKMNSMFVVDGKVKKACKVLLEGDS 766 Query: 478 GTGKTTFIRMLAGNLEPD--DGSGQLPQLHI 564 G GKTT + LA + GS P++ + Sbjct: 767 GAGKTTLTKKLASDWAKGVLSGSSTFPEVEL 797 >SB_41103| Best HMM Match : p450 (HMM E-Value=0) Length = 524 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -3 Query: 317 DSVLNRIFSVGTNPSRNILIPSLTEK-GIVTTP*APGTP 204 D V + + ++ N + ++ L G VTTP PGTP Sbjct: 320 DQVKSYVIAISANTDESTMLTVLANSVGAVTTPANPGTP 358 >SB_34413| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 650 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 352 EEIKRMNHYEYPEMSKHMGDFDLRVMPGEFSDSEILVLLGENGTGKT 492 +E K YE P + D R M D+ I++ GE+G+GKT Sbjct: 64 QEYKMREMYERPPHIFALADASYRAMKRRSEDTCIMIS-GESGSGKT 109 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 27.5 bits (58), Expect = 8.6 Identities = 8/17 (47%), Positives = 16/17 (94%) Frame = +1 Query: 445 DSEILVLLGENGTGKTT 495 D+++++++GE G+GKTT Sbjct: 624 DNQVVIIVGETGSGKTT 640 >SB_55554| Best HMM Match : AAA (HMM E-Value=0.022) Length = 1681 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = +1 Query: 457 LVLLGENGTGKTTFIRMLAGNL 522 +V+LG+ G+GKTT + L+G++ Sbjct: 270 VVVLGDAGSGKTTLLHALSGSV 291 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 415 DLRVMPGEFSDSEILVLLGENGTGKTTFIRMLAGNLEPDDGSGQLPQLH-ISYKPQKISP 591 ++ ++ G+F D ++ G+T++ ++ PDD SG L ++ + KP+K +P Sbjct: 949 EVEIVGGDF-DRANPNMMQLKSDGETSYADIIPDGKNPDDSSGPLGDVYAVVNKPKKSAP 1007 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +1 Query: 442 SDSEILVLLGENGTGKTTFIRMLA 513 + E ++L+GE GTGKT+ ++ LA Sbjct: 445 NQQEPVLLVGETGTGKTSSVQTLA 468 >SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1570 Score = 27.5 bits (58), Expect = 8.6 Identities = 29/122 (23%), Positives = 45/122 (36%), Gaps = 3/122 (2%) Frame = +1 Query: 1 QRFACAMVCIQNADIFMFDEPSSYLDV---KQRLNAARTIRSLINPDKFIIVVEHDLSVL 171 QR A NAD+++ D+P S +D K + R + K ++V H +S L Sbjct: 677 QRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLR-KKTRVLVTHGISFL 735 Query: 172 DYLSDFICCLYGVPGAYGVVTMPFSVREGINIFLDGFVPTENMRFRTESLVFKVAESATE 351 + + G G + R FL F P E ++ KV E Sbjct: 736 PQVDQIVVLQDGRVSEVGTYKELLANRGAFAEFLKTFAPEE----KSGDAALKVLREVPE 791 Query: 352 EE 357 +E Sbjct: 792 DE 793 >SB_33973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1184 Score = 27.5 bits (58), Expect = 8.6 Identities = 23/82 (28%), Positives = 38/82 (46%) Frame = +1 Query: 4 RFACAMVCIQNADIFMFDEPSSYLDVKQRLNAARTIRSLINPDKFIIVVEHDLSVLDYLS 183 R + A AD+++ D+P LDV ++AR R + P I + E D+ V+ +S Sbjct: 543 RVSLARAVYAKADVYLLDDPLRSLDVNVAEDSAR--RPVQQPTG-IFIDEEDI-VIGNIS 598 Query: 184 DFICCLYGVPGAYGVVTMPFSV 249 I Y G G+ + +V Sbjct: 599 WGIYLRYLTAGVTGIALLLMAV 620 >SB_23377| Best HMM Match : WH1 (HMM E-Value=2.8) Length = 355 Score = 27.5 bits (58), Expect = 8.6 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 4/66 (6%) Frame = +1 Query: 307 RTESLVFKVAESATEEEIKRMNHYEYPEMSKHMGDFDLRVMP--GEF--SDSEILVLLGE 474 R E+ K+ + E ++ N+Y PE+ G + L V+P GE+ S + E Sbjct: 148 RCEAPALKITRWEEDSEKRQGNNYNMPEVLASGGPYPLVVLPVGGEYWLEGSNHQYAVQE 207 Query: 475 NGTGKT 492 NG +T Sbjct: 208 NGMPRT 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,127,922 Number of Sequences: 59808 Number of extensions: 346562 Number of successful extensions: 1057 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -