BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K17 (578 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0105 - 14828097-14828226,14828371-14828547,14829690-148297... 28 6.2 03_02_0045 - 5251234-5251305,5251362-5251419,5252256-5252539,525... 27 8.2 >10_08_0105 - 14828097-14828226,14828371-14828547,14829690-14829739, 14829841-14829909,14829976-14830074,14830148-14830226, 14830587-14830687,14830794-14830862,14831019-14831059, 14831313-14831663,14831676-14832511,14832674-14832777, 14833587-14834003,14836108-14836491 Length = 968 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 278 IYGVSGNRIHSKKVPELVSVQRGYYELGLEKIKV 177 I+G+SG K+P L +Q +LG E I V Sbjct: 146 IFGLSGESARQGKMPSLAELQTSIGDLGFEVIVV 179 >03_02_0045 - 5251234-5251305,5251362-5251419,5252256-5252539, 5252836-5253019,5253564-5253814,5253921-5254024, 5254143-5254281 Length = 363 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 4 SCISQTPPPNPSAQVPP 54 S SQ PPP PSA PP Sbjct: 28 SAASQPPPPPPSAATPP 44 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,265,225 Number of Sequences: 37544 Number of extensions: 274459 Number of successful extensions: 743 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -