BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K12 (146 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X02760-1|CAA26535.1| 431|Homo sapiens protein ( Human mRNA for ... 30 1.1 X02419-1|CAA26268.1| 431|Homo sapiens urokinase-plasminogen act... 30 1.1 M15476-1|AAA61253.1| 431|Homo sapiens PLAU protein. 30 1.1 K03226-1|AAC97138.1| 431|Homo sapiens PLAU protein. 30 1.1 K02286-1|AAA61252.1| 366|Homo sapiens urokinase protein. 30 1.1 D11143-1|BAA01919.1| 411|Homo sapiens urokinase-type plasminoge... 30 1.1 D00244-1|BAA00175.1| 431|Homo sapiens pro-urokinase precursor p... 30 1.1 BT007391-1|AAP36055.1| 431|Homo sapiens plasminogen activator, ... 30 1.1 BC013575-1|AAH13575.1| 431|Homo sapiens plasminogen activator, ... 30 1.1 AY820134-1|AAV70488.1| 411|Homo sapiens urokinase plasminogen a... 30 1.1 AY029537-1|AAK38734.1| 154|Homo sapiens urokinase-type plasmino... 30 1.1 AL596247-7|CAI13970.1| 395|Homo sapiens plasminogen activator, ... 30 1.1 AL596247-6|CAI13969.1| 431|Homo sapiens plasminogen activator, ... 30 1.1 AF377330-1|AAK53822.1| 431|Homo sapiens urokinase-type plasmino... 30 1.1 >X02760-1|CAA26535.1| 431|Homo sapiens protein ( Human mRNA for urokinase (EC 3.4.99.26). ). Length = 431 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 >X02419-1|CAA26268.1| 431|Homo sapiens urokinase-plasminogen activator protein. Length = 431 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 >M15476-1|AAA61253.1| 431|Homo sapiens PLAU protein. Length = 431 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 >K03226-1|AAC97138.1| 431|Homo sapiens PLAU protein. Length = 431 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 >K02286-1|AAA61252.1| 366|Homo sapiens urokinase protein. Length = 366 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 18 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 49 >D11143-1|BAA01919.1| 411|Homo sapiens urokinase-type plasminogen activater protein. Length = 411 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 63 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 94 >D00244-1|BAA00175.1| 431|Homo sapiens pro-urokinase precursor protein. Length = 431 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 >BT007391-1|AAP36055.1| 431|Homo sapiens plasminogen activator, urokinase protein. Length = 431 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 >BC013575-1|AAH13575.1| 431|Homo sapiens plasminogen activator, urokinase protein. Length = 431 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 >AY820134-1|AAV70488.1| 411|Homo sapiens urokinase plasminogen activator protein. Length = 411 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 63 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 94 >AY029537-1|AAK38734.1| 154|Homo sapiens urokinase-type plasminogen activator amino-terminal fragment protein. Length = 154 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 >AL596247-7|CAI13970.1| 395|Homo sapiens plasminogen activator, urokinase protein. Length = 395 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 47 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 78 >AL596247-6|CAI13969.1| 431|Homo sapiens plasminogen activator, urokinase protein. Length = 431 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 >AF377330-1|AAK53822.1| 431|Homo sapiens urokinase-type plasminogen activator protein. Length = 431 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 38 TTVYMNRPC*PWTFTYMSSSTLHIHRSGLRRL 133 +T M RPC PW + T H HRS +L Sbjct: 83 STDTMGRPCLPWNSATVLQQTYHAHRSDALQL 114 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,557,745 Number of Sequences: 237096 Number of extensions: 335082 Number of successful extensions: 773 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 76,859,062 effective HSP length: 29 effective length of database: 69,983,278 effective search space used: 1329682282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -