BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K10 (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 3.1 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 3.1 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 7.1 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 7.1 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 7.1 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 9.4 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/25 (28%), Positives = 11/25 (44%) Frame = +1 Query: 157 INKKQNTWKAGRNFPTHTPFAHIKI 231 +N + TW GR PF + + Sbjct: 129 VNSRPETWVLGREMCKAVPFVELTV 153 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/25 (28%), Positives = 11/25 (44%) Frame = +1 Query: 157 INKKQNTWKAGRNFPTHTPFAHIKI 231 +N + TW GR PF + + Sbjct: 129 VNSRPETWVLGREMCKAVPFVELTV 153 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 112 PQQREYTRARRTEHTKEPSFSILFSFTESI 23 P E + + H+ E SFS S+T +I Sbjct: 194 PTCSEASSSPTPSHSSESSFSAASSYTNTI 223 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 524 PPLQPRPHIGQQ 489 PP+Q +P+ GQQ Sbjct: 208 PPIQQQPNQGQQ 219 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 524 PPLQPRPHIGQQ 489 PP+Q +P+ GQQ Sbjct: 210 PPIQQQPNQGQQ 221 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 186 SFPCVLFLIYQIYKR 142 SF C+LF IY +++ Sbjct: 14 SFCCILFFIYLYWQQ 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,238 Number of Sequences: 336 Number of extensions: 2682 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -