BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K09 (248 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 2.6 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 19 7.9 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 19 7.9 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 19 7.9 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 20.6 bits (41), Expect = 2.6 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +1 Query: 19 MPFARYVEPGRVALVSDGPLKGKLVG--VVDIIDQTRALIDGPGSGVSRQQIRSTI 180 M +A+ ++PG LVSD K L+ +V + R+ + P +GV + + Sbjct: 191 MKYAQKLQPGDFLLVSDN-AKNALISEKIVRLEAVWRSGVFAPLTGVGTLVVNDVV 245 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 19.0 bits (37), Expect = 7.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 39 RTRASRPGF*WTSKRK 86 RT S P F W K+K Sbjct: 316 RTLGSLPPFKWLFKKK 331 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 19.0 bits (37), Expect = 7.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +1 Query: 205 YPFYSTHTCCQK 240 + FY HT C K Sbjct: 29 FGFYPHHTSCDK 40 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 19.0 bits (37), Expect = 7.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +1 Query: 205 YPFYSTHTCCQK 240 + FY HT C K Sbjct: 29 FGFYPHHTSCDK 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 55,173 Number of Sequences: 336 Number of extensions: 917 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 47 effective length of database: 106,793 effective search space used: 3737755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.4 bits)
- SilkBase 1999-2023 -