BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K07 (589 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0345 - 3811057-3811236,3811342-3811615,3811732-3812289,381... 32 0.39 10_06_0085 + 10511258-10512327,10512978-10513058,10513318-105133... 30 1.2 03_06_0604 - 35006004-35008580 29 2.1 10_06_0143 - 11183574-11183761,11183989-11184344,11184437-111845... 29 3.6 03_05_0449 - 24437994-24438157,24438265-24438383,24438489-24438760 28 6.3 03_02_0602 + 9759055-9759223,9759305-9759455,9759548-9759593,975... 28 6.3 06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905,581... 27 8.4 03_05_0478 - 24712157-24712177,24712206-24712260,24712377-247124... 27 8.4 01_06_0946 + 33220910-33222221,33223373-33223734,33223863-332240... 27 8.4 01_01_0256 - 2083973-2084816,2084922-2086093 27 8.4 >10_01_0345 - 3811057-3811236,3811342-3811615,3811732-3812289, 3812602-3812747,3812930-3813097,3813896-3814003, 3814859-3815029,3816557-3816949,3817522-3817617, 3817715-3817774,3818600-3818744,3819296-3819520, 3820106-3820254 Length = 890 Score = 31.9 bits (69), Expect = 0.39 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 433 LCGGSLISSKYVLTAAHCVTGAILIEGTPKNVRLGEYNTTNNGPDCMK 576 +C + +Y + A C L+E P+ + G+Y +T PDC K Sbjct: 416 VCSQLFTTHQYTFSIACCFCNDYLLETRPERLGQGQYKSTLVCPDCKK 463 >10_06_0085 + 10511258-10512327,10512978-10513058,10513318-10513396, 10514160-10514201 Length = 423 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 199 PETFSVCCGPPPEINPEDMTLNERCSRAVTA 291 P ++ C PE+ D L R SRA+TA Sbjct: 30 PGSYEAACSADPELGTFDTALRRRASRAITA 60 >03_06_0604 - 35006004-35008580 Length = 858 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 5/51 (9%) Frame = +1 Query: 19 CGYENNIPMVCCPISN-ACKTPDDKPGIC---VGLYNCE-HITYMMLDKTR 156 CGY P+ CP N P D G C + L NC + T + LD T+ Sbjct: 291 CGYNGTSPVCRCPSENFQLSNPADPRGGCRRKIELQNCPGNSTMLQLDNTQ 341 >10_06_0143 - 11183574-11183761,11183989-11184344,11184437-11184592, 11184825-11184994,11185906-11186064,11186856-11187164, 11187281-11187576,11187825-11188174,11188279-11188434, 11188634-11188803,11189289-11189447,11190702-11191010, 11191172-11191458,11191911-11192263,11192366-11192521, 11192680-11192849,11195800-11195958,11196937-11197254, 11197658-11197786 Length = 1449 Score = 28.7 bits (61), Expect = 3.6 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 7/79 (8%) Frame = -3 Query: 440 PHSSFI*SKLSYSITTSHGYWVIFVSFPPTILLTTVSSTPQHSLLLSSG----KAVTAL- 276 P+ SF+ +K + S+T +G + + P++ + + PQ + +G KA L Sbjct: 1101 PNGSFLQAKTANSVTADYGESTNWGNDDPSVFIVDMVGGPQGEYQICNGYGAEKASQVLR 1160 Query: 275 EHLSLRVISSG--FISGGG 225 EH S ++ S FIS G Sbjct: 1161 EHWSTYIVESDFEFISSSG 1179 >03_05_0449 - 24437994-24438157,24438265-24438383,24438489-24438760 Length = 184 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 548 VLYSPKRTF-FGVPSIKIAPVTQCAAVSTYFELMSEPPHSSF 426 + Y P R + VPS I C V F ++ PP +SF Sbjct: 85 ITYYPSRYWALAVPSFVIVATALCMVVYVGFNFLATPPPTSF 126 >03_02_0602 + 9759055-9759223,9759305-9759455,9759548-9759593, 9759974-9760033,9760519-9760555,9761268-9761347, 9761413-9761516,9761613-9761673,9762962-9763019, 9763866-9763918,9764357-9765320,9766131-9766185, 9767223-9768786 Length = 1133 Score = 27.9 bits (59), Expect = 6.3 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = -3 Query: 368 VSFPPTILLTTVSSTPQHSLLLSSGKAVTALEHLSLRVISSGFISGGGPQHTLNVSGPLQ 189 V+ P +I TVS + + AV A + + + + G S G P H N+SGPL Sbjct: 577 VAEPQSIPAPTVSVRTTGGHVRGNVAAVKAAQIVPTQC-TDGLRSFGSPHHFTNLSGPLT 635 Query: 188 T 186 T Sbjct: 636 T 636 >06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905, 5819969-5820064,5820147-5820266,5820401-5820663, 5821507-5821617 Length = 363 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 429 AAMRW-LTHQFEVRAHCCTLC 488 AA+RW LTH E A CC C Sbjct: 264 AAVRWGLTHHKESAADCCQAC 284 >03_05_0478 - 24712157-24712177,24712206-24712260,24712377-24712473, 24712558-24713302,24713822-24714189,24714279-24714419, 24715480-24715849 Length = 598 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 226 PPPEINPEDMTLNERCSRAVTAFPLESNN 312 P P +P ++ +E SRA +A LESNN Sbjct: 99 PSPAASPSELGDDESWSRAPSAAELESNN 127 >01_06_0946 + 33220910-33222221,33223373-33223734,33223863-33224073, 33224174-33224411,33224492-33224642,33224733-33224997, 33231775-33231820,33232167-33232815,33232883-33233384, 33235023-33235360,33235466-33235676,33235769-33235992, 33236042-33236115,33236147-33236234,33236316-33236612 Length = 1655 Score = 27.5 bits (58), Expect = 8.4 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 364 DTKITQYPWLVVIEYESFDHMKLLCGGSLISSKYVLTAAHCVTGAIL-IEGTPKN 525 D + +Y WL+ E S D + L GGS S+ + C+ A+L +E P+N Sbjct: 752 DLNLLRYSWLLWKEGRSVDLLDQLLGGSFDYSEVL----RCIQVALLCVEVQPRN 802 >01_01_0256 - 2083973-2084816,2084922-2086093 Length = 671 Score = 27.5 bits (58), Expect = 8.4 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 226 PPPEINPEDMTLNERCSRAVTAFPLESNNECCGVEDTVVNKIVGG 360 PP + PED + R + V P+E + G+ D V ++GG Sbjct: 290 PPIRVRPEDRPPDSRLAPQV---PVEDHFAQMGISDQPVQPVIGG 331 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,086,798 Number of Sequences: 37544 Number of extensions: 357575 Number of successful extensions: 867 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -