BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K06 (600 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch... 28 1.2 SPAC977.15 |||dienelactone hydrolase family|Schizosaccharomyces ... 27 2.8 SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces... 26 3.7 SPBC337.05c |cct8||chaperonin-containing T-complex theta subunit... 26 4.8 SPCC126.13c |||histone deacetylase complex subunit, SAP128 famil... 25 6.4 SPCC188.13c |dcr1|SPCC584.10c|dicer|Schizosaccharomyces pombe|ch... 25 8.5 SPAC21E11.07 ||SPAC2C4.01|glycine cleavage T-protein|Schizosacch... 25 8.5 >SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2196 Score = 27.9 bits (59), Expect = 1.2 Identities = 24/85 (28%), Positives = 35/85 (41%), Gaps = 2/85 (2%) Frame = +3 Query: 276 DVEMLARLILG--GMNVANDDAKMFHMMTMFRKMLSYNQYNMDKYTYVPTALDMYTTCLR 449 D + + LI G G DD +H M + L + Y K + AL TTC Sbjct: 1526 DFNVESSLITGLRGKTKKEDDLVKYHNMILKTIELLSSSYPELKQIWGEVALSWATTC-- 1583 Query: 450 DPVFWKIMKRVMNSFVLFKNMLPSY 524 + NSF LF+++LP + Sbjct: 1584 -----PSRRLACNSFQLFRSLLPDF 1603 >SPAC977.15 |||dienelactone hydrolase family|Schizosaccharomyces pombe|chr 1|||Manual Length = 247 Score = 26.6 bits (56), Expect = 2.8 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = -1 Query: 246 HHDVRFCLLGFLRGSSAQHHLEAFSV*DSRS*PEQNYFDELASHLHWPKI 97 +H++ L FL G +A + + + + ++++S LHWPK+ Sbjct: 66 NHELAIYLPDFLNGETASIEMIDPKTIEQKE-ARSKFMEKISSPLHWPKL 114 >SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 26.2 bits (55), Expect = 3.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +3 Query: 495 VLFKNMLPSYTREELDF 545 +L +N LPSYT EEL F Sbjct: 176 LLIENPLPSYTSEELKF 192 >SPBC337.05c |cct8||chaperonin-containing T-complex theta subunit Cct8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 546 Score = 25.8 bits (54), Expect = 4.8 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 174 KMLLDDVEQMIREGILTGKIERRDGTMINLKKPEDVEMLARLILGG 311 K LDD+E+ I +G+ K +D +I D+++ RLI G Sbjct: 382 KTYLDDLERAIDDGVNIVKALVKDNRLIFGAGASDMQLCIRLISVG 427 >SPCC126.13c |||histone deacetylase complex subunit, SAP128 family |Schizosaccharomyces pombe|chr 3|||Manual Length = 145 Score = 25.4 bits (53), Expect = 6.4 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 396 DKYTYVPTALDMYTTCLRDPVFW---KIMKR 479 DKY P A D+ T CL +P + K++KR Sbjct: 93 DKYKDRPIARDLGTVCLHNPKLFQGNKLLKR 123 >SPCC188.13c |dcr1|SPCC584.10c|dicer|Schizosaccharomyces pombe|chr 3|||Manual Length = 1374 Score = 25.0 bits (52), Expect = 8.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 45 SCRIPAAQGDPTSS 4 +C++PAAQG P S Sbjct: 579 ACKVPAAQGSPAKS 592 >SPAC21E11.07 ||SPAC2C4.01|glycine cleavage T-protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 25.0 bits (52), Expect = 8.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 93 LPNGDEMPITVLDGFTSCRIPAAQGDPTSSR 1 +PN ++ P V++ I A QG+P S R Sbjct: 243 IPNYEDNPSQVIEPSAPLSIVAKQGEPVSRR 273 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,588,989 Number of Sequences: 5004 Number of extensions: 54516 Number of successful extensions: 165 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -