BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_K05 (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) 31 0.58 SB_52724| Best HMM Match : adh_short (HMM E-Value=5.1e-08) 29 3.1 SB_38059| Best HMM Match : Zfx_Zfy_act (HMM E-Value=2.6) 29 3.1 SB_35407| Best HMM Match : PKD (HMM E-Value=1.8e-11) 28 5.4 SB_21037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_31651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_44176| Best HMM Match : PAP_assoc (HMM E-Value=0.56) 28 7.1 SB_12097| Best HMM Match : Birna_VP5 (HMM E-Value=4.6) 28 7.1 >SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) Length = 733 Score = 31.5 bits (68), Expect = 0.58 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +1 Query: 310 LLDSNGYTKTKNWNGYPPSVPLGNINLFGMHSKPSDIYNGTFPSS--NNFMRSVNGKE 477 ++DS G N+ G+ VP G++ L+G H+ + FP S N+F+ V G+E Sbjct: 439 IVDSFGTEAQFNYAGFTEKVPGGSMALWGRHNLNLKQFMTMFPHSPDNSFLGFVVGEE 496 >SB_52724| Best HMM Match : adh_short (HMM E-Value=5.1e-08) Length = 316 Score = 29.1 bits (62), Expect = 3.1 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 6/73 (8%) Frame = +3 Query: 114 RNIIGFRKV-RGNVEFVRKVLAFVVYEDILKEHIRLFEARRVRWTVEWIAKR-----LVI 275 R IIG R + RGN VR + A + + EH+ L VR E I K+ +++ Sbjct: 63 RVIIGARNLDRGNAA-VRDIQASSGSQQVFVEHLDLASLSSVRKFAEVINKKEERVDILM 121 Query: 276 NNKGLKWCQIMAT 314 NN G+ W T Sbjct: 122 NNAGVAWIPFKRT 134 >SB_38059| Best HMM Match : Zfx_Zfy_act (HMM E-Value=2.6) Length = 722 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -2 Query: 262 LAIHSTVQRTRRASKSLICSLRMSSYTTKASTFLTNS 152 LA+ + RTRRA+KSL L+ S + + S LT S Sbjct: 443 LAVKQSSPRTRRANKSLQAPLKPPSSSPRPSKALTGS 479 >SB_35407| Best HMM Match : PKD (HMM E-Value=1.8e-11) Length = 159 Score = 28.3 bits (60), Expect = 5.4 Identities = 22/86 (25%), Positives = 36/86 (41%) Frame = +1 Query: 289 SNGVRSWLLDSNGYTKTKNWNGYPPSVPLGNINLFGMHSKPSDIYNGTFPSSNNFMRSVN 468 S G + +S GY K NW +P P + ++P+ +YN P + N +V Sbjct: 69 SGGTVKYKNESTGYIKAYNWT-FPGGTPSTS-----TLAEPTVVYN--TPGTYNVQLTVT 120 Query: 469 GKESSLKSENSFELRTILFCPGVILC 546 GK ++ + TI P + C Sbjct: 121 GKNNNTNNATKNNYITIHQKPNLNYC 146 >SB_21037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +3 Query: 234 VRWTVEWIAKRLVINNKGLKWCQIMATRFKRIYENKELEWISTF 365 ++W +I R ++ N +KW + ++ I N +EW+ F Sbjct: 49 IKWLRCFIVWRGIVTNSAIKWLRCFIV-WRGIVTNSAIEWLRCF 91 >SB_31651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 827 Score = 27.9 bits (59), Expect = 7.1 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Frame = +3 Query: 102 LLLFRNIIGFRKVRGNVEFVRKVLAFVVYEDILKEHIRL-----FEARRVRWTVEWIAK- 263 LLLF + FR V GN+ F + Y D++ R+ F + W + ++K Sbjct: 388 LLLFMRNLTFRGVTGNIRFEKSGNPTNAYYDVMNFRKRVPGGKYFIEKVGFWKRDQVSKP 447 Query: 264 RLVINNKGLKW 296 +L +N K ++W Sbjct: 448 QLQVNGKLIQW 458 >SB_44176| Best HMM Match : PAP_assoc (HMM E-Value=0.56) Length = 579 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -2 Query: 226 ASKSLICSLRMSSYTTKASTFLTNSTFPLTFLKPM 122 A K LIC+L S++ + S T PL++L PM Sbjct: 96 AFKVLICTLLFSAFRLERSPSTPPITAPLSYLPPM 130 >SB_12097| Best HMM Match : Birna_VP5 (HMM E-Value=4.6) Length = 383 Score = 27.9 bits (59), Expect = 7.1 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = -2 Query: 265 LLAIHSTVQRTRRASKSLICSLRMSSYT---TKASTFLTNSTFP 143 L A H+T+ RTR S+S CSLR + + TK+ T+ T P Sbjct: 232 LYARHNTLTRTRAPSRS--CSLRTAQHPHTGTKSPMLSTHGTTP 273 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,505,936 Number of Sequences: 59808 Number of extensions: 382460 Number of successful extensions: 987 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -