BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J22 (532 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45199| Best HMM Match : Ribosomal_S15 (HMM E-Value=1.5e-21) 210 4e-55 SB_45487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_29938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_9366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_29135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_20321| Best HMM Match : DUF1653 (HMM E-Value=1.4) 28 4.1 SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_13861| Best HMM Match : Collagen (HMM E-Value=0.00048) 28 5.4 SB_51336| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) 27 9.5 SB_8395| Best HMM Match : Arm (HMM E-Value=2.3) 27 9.5 SB_43376| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_38863| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=2.3) 27 9.5 >SB_45199| Best HMM Match : Ribosomal_S15 (HMM E-Value=1.5e-21) Length = 135 Score = 210 bits (514), Expect = 4e-55 Identities = 97/116 (83%), Positives = 109/116 (93%) Frame = +1 Query: 109 WLKLTADDVKEQIFKLGKKGLTPSQIGVMLRDSHGVAQVRFVTGKKILRIMKAMGLAPDL 288 W KLT+DDVKEQ++KL KKGLTPSQIGV+LRDS+GVAQVR++TG KILRI+KA GLAP L Sbjct: 20 WQKLTSDDVKEQMYKLAKKGLTPSQIGVILRDSYGVAQVRYITGNKILRILKAKGLAPSL 79 Query: 289 PEDLYYLIKKAVAMRKHLERNRKDKDSKFRLILVESRIHRLARYYKTKSVLPPNWK 456 PEDLY LIKKAVA+RKHLE+NRKDKDSKFRLIL+ESRIHRLARY+KTK VLPPNWK Sbjct: 80 PEDLYCLIKKAVAVRKHLEKNRKDKDSKFRLILIESRIHRLARYFKTKRVLPPNWK 135 >SB_45487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1236 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/65 (30%), Positives = 27/65 (41%) Frame = -2 Query: 234 NKSDLCNTMRVPEHDTDLGRSKTLFAKFEDLFLNIISG*FQPGRDTAAVRQRRLGYTLAR 55 +K ++ T + E+ D G K F F DL P D + + LGY Sbjct: 620 DKFNVSGTQTLGENIADGGGLKLAFMAFRDLEKEKGPEEILPLLDMPSEKLFFLGYAQKE 679 Query: 54 CVHTT 40 CVHTT Sbjct: 680 CVHTT 684 >SB_29938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 190 VMLRDSHGVAQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKK 318 V L D HG + + + + + RI++AM PED L KK Sbjct: 211 VTLVDDHGYSAMDVTSSQSVRRILRAMPGLFQKPEDQLQLTKK 253 >SB_9366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1221 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +3 Query: 15 DIIKSRQYGSYA-RTWQGY--IPVGAAVPPQCP 104 D++ S+QYGSY ++QGY P +PP P Sbjct: 123 DLMGSQQYGSYTDSSYQGYSTYPSQGRIPPASP 155 >SB_29135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 102 DTAAVRQRRLGYTLARCVHTTHIGGFLLY 16 DT ++ RLG L RCV T I G +++ Sbjct: 48 DTVGLKHARLGKVLWRCVRTRLIMGMIMF 76 >SB_20321| Best HMM Match : DUF1653 (HMM E-Value=1.4) Length = 103 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 102 DTAAVRQRRLGYTLARCVHTTHIGGFLLY 16 DT ++ RLG L RCV T I G +++ Sbjct: 64 DTVGLKHARLGKVLWRCVRTRLIMGMIMF 92 >SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 28.3 bits (60), Expect = 4.1 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = +1 Query: 67 ISQSALPYRRSVPTWLKLTADDVKEQIFKLGKKGLTPSQIGVM--LRDSHGVAQVRFVTG 240 +S LP +RS+ + +L +D ++ K + V+ + D G A + G Sbjct: 745 LSHDDLPAQRSLGVYWELRSDSFAYRVSPPDKPFTRRGVLSVVNSVYDPLGHAAPVMLQG 804 Query: 241 KKILRIMKAMGLAPD 285 KKIL+ + AMG P+ Sbjct: 805 KKILQRLVAMGKKPE 819 >SB_13861| Best HMM Match : Collagen (HMM E-Value=0.00048) Length = 763 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 151 KLGKKGLTPSQIGVMLRD 204 KL K+GL+PSQI V+ RD Sbjct: 465 KLNKEGLSPSQIYVLARD 482 >SB_51336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/49 (28%), Positives = 29/49 (59%) Frame = -2 Query: 369 AVLVLPITFQMFPHGDSLLDQVVQIFR*IRSKTHSFHDTQDLFTSNKSD 223 +VL+ IT+ + S ++ I +R++ ++F+DT+D+FT +D Sbjct: 36 SVLLREITYPSMENKSSWSQNMLNI---LRTRLNNFYDTEDVFTIVMND 81 >SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) Length = 961 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +1 Query: 280 PDLPEDLYYL-IKKAVAMRKHLE-RNRKDKDSKFRLILVESRIHRLARYY 423 PD+P+D YYL + +++M L KD K +L++ L Y+ Sbjct: 146 PDIPDDNYYLSLSTSISMASVLSGSEEKDNFLKLCRLLIDGGTKSLLTYF 195 >SB_8395| Best HMM Match : Arm (HMM E-Value=2.3) Length = 412 Score = 27.1 bits (57), Expect = 9.5 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +2 Query: 254 VS*KLWVLLLIYRKICTT*SRRLSP*GNIWNVIG--RTRTANSG*FLLNQGFTG*LVITR 427 VS +LW LL + ++CT SR L+ G W + T + ++L +G +V+TR Sbjct: 85 VSCRLWYLLEVSCRLCTY-SRDLAGYGTYWRYLAGYGTYSRYLAGYVLTRGILQAMVLTR 143 >SB_43376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.1 bits (57), Expect = 9.5 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = +1 Query: 61 KGISQSALPYRRSVPTWLKLTADDVKEQIFKLGKKGLTPSQIGVMLRD-SHGVAQVRFVT 237 +G S S R S+PTWL+L + + + Q V L+D +H A +++ Sbjct: 54 RGSSTSNAAPRTSLPTWLQLPGPVLLRRFVRANNNDPLVDQ--VELKDANHTYAHIQYAD 111 Query: 238 GKKILRIMKAMGLAPDLPED 297 G++ + LAP P++ Sbjct: 112 GRE--STVSLRDLAPCPPQN 129 >SB_38863| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=2.3) Length = 284 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = +1 Query: 262 KAMGLAPDLPEDLYYLIKKAVAMRKHL---ERNRKDKDSKFRLILVESRIHRLARYYKTK 432 +A G+APD P +L LIK+ + + + + R+ K+ + + R+ + R +TK Sbjct: 124 RASGIAPDEPSELDQLIKQIIELEETTVPEDSQRQAKEKANKAKAEDVRLTAMERLSQTK 183 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,327,748 Number of Sequences: 59808 Number of extensions: 337349 Number of successful extensions: 805 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -