BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J21 (529 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) 31 0.59 SB_18251| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=9.9) 29 1.8 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 28 4.1 SB_3669| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_2182| Best HMM Match : EGF_CA (HMM E-Value=0) 27 7.2 SB_40488| Best HMM Match : HEAT (HMM E-Value=6.3e-08) 27 9.6 >SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) Length = 1146 Score = 31.1 bits (67), Expect = 0.59 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = -1 Query: 430 SNFRSHLRSPAMS*HPNNSSVHRPRTYEQLAPSEDRS 320 S +S LR P S P+ SS H P T +Q +PS+++S Sbjct: 282 SRHQSSLRHPGSS-KPSTSSKHYPATIDQNSPSKNKS 317 >SB_18251| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=9.9) Length = 93 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 53 YGMGYNQMPFHPEHHHNRLRSP 118 Y Y+ PFHP HH R R P Sbjct: 30 YFYRYHHRPFHPHHHRIRRRPP 51 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 300 GHRCQSPDRSSDGASCS*VRGRC 368 GH C P ++GA C+ V G+C Sbjct: 363 GHNCAHPCNCTNGARCNAVTGQC 385 >SB_3669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 29 AAVSAAPYYGMGYNQMPFHPEHHHNRLRSPYFGEDVF 139 A +S AP Y + PF P H+ + G ++F Sbjct: 76 AGISLAPLYYTAFTNAPFPPRDHYQYYIFVFLGGELF 112 >SB_2182| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 299 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = +1 Query: 361 GDVQKNYLDVRTLP---DCVNVNGSWT 432 GD+ + L V T P DCVN NGS+T Sbjct: 257 GDIDECALGVATCPASADCVNNNGSYT 283 >SB_40488| Best HMM Match : HEAT (HMM E-Value=6.3e-08) Length = 1185 Score = 27.1 bits (57), Expect = 9.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 5 ALFVLCLAAAVSAAPYYGMGYNQMPF 82 +LF+LC+ A+ APY+ Y + Sbjct: 806 SLFLLCIQASAVRAPYFSCAYRHQQY 831 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,570,410 Number of Sequences: 59808 Number of extensions: 381558 Number of successful extensions: 943 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 943 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -