BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_J21 (529 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U04435-1|AAA18958.1| 609|Drosophila melanogaster GLI-Kr zinc fi... 32 0.42 BT029391-1|ABK56895.1| 609|Drosophila melanogaster FI01113p pro... 32 0.42 AY051783-1|AAK93207.1| 609|Drosophila melanogaster LD30441p pro... 32 0.42 AE014297-163|AAF52084.1| 609|Drosophila melanogaster CG1133-PA ... 32 0.42 AY075095-1|AAL79357.1| 815|Drosophila melanogaster pygopus prot... 31 0.73 AY058500-1|AAL13729.1| 815|Drosophila melanogaster LD18280p pro... 31 0.73 AF457206-1|AAL91369.1| 815|Drosophila melanogaster pygopus prot... 31 0.73 AE014297-4758|AAF57161.1| 815|Drosophila melanogaster CG11518-P... 31 0.73 AY061041-1|AAL28589.1| 430|Drosophila melanogaster HL08023p pro... 28 6.8 AE014298-1646|AAF48065.2| 430|Drosophila melanogaster CG1561-PA... 28 6.8 AE014298-1645|AAS65318.1| 635|Drosophila melanogaster CG1561-PB... 28 6.8 AE013599-302|AAF59293.1| 328|Drosophila melanogaster CG12835-PA... 28 9.0 >U04435-1|AAA18958.1| 609|Drosophila melanogaster GLI-Kr zinc finger pair-rule proteinprotein. Length = 609 Score = 32.3 bits (70), Expect = 0.42 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 56 GMGYNQMPFHPEHHHNRLR 112 G G+ Q PFH HHH+++R Sbjct: 125 GSGFGQHPFHSHHHHHQMR 143 >BT029391-1|ABK56895.1| 609|Drosophila melanogaster FI01113p protein. Length = 609 Score = 32.3 bits (70), Expect = 0.42 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 56 GMGYNQMPFHPEHHHNRLR 112 G G+ Q PFH HHH+++R Sbjct: 125 GSGFGQHPFHSHHHHHQMR 143 >AY051783-1|AAK93207.1| 609|Drosophila melanogaster LD30441p protein. Length = 609 Score = 32.3 bits (70), Expect = 0.42 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 56 GMGYNQMPFHPEHHHNRLR 112 G G+ Q PFH HHH+++R Sbjct: 125 GSGFGQHPFHSHHHHHQMR 143 >AE014297-163|AAF52084.1| 609|Drosophila melanogaster CG1133-PA protein. Length = 609 Score = 32.3 bits (70), Expect = 0.42 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 56 GMGYNQMPFHPEHHHNRLR 112 G G+ Q PFH HHH+++R Sbjct: 125 GSGFGQHPFHSHHHHHQMR 143 >AY075095-1|AAL79357.1| 815|Drosophila melanogaster pygopus protein. Length = 815 Score = 31.5 bits (68), Expect = 0.73 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 83 HPEHHHNRLRSPYFGEDVFDTVGSGPNSP 169 HP HHHN + P G ++F G GP P Sbjct: 669 HPHHHHNPMGGP--GPNMFGGGGGGPMGP 695 >AY058500-1|AAL13729.1| 815|Drosophila melanogaster LD18280p protein. Length = 815 Score = 31.5 bits (68), Expect = 0.73 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 83 HPEHHHNRLRSPYFGEDVFDTVGSGPNSP 169 HP HHHN + P G ++F G GP P Sbjct: 669 HPHHHHNPMGGP--GPNMFGGGGGGPMGP 695 >AF457206-1|AAL91369.1| 815|Drosophila melanogaster pygopus protein. Length = 815 Score = 31.5 bits (68), Expect = 0.73 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 83 HPEHHHNRLRSPYFGEDVFDTVGSGPNSP 169 HP HHHN + P G ++F G GP P Sbjct: 669 HPHHHHNPMGGP--GPNMFGGGGGGPMGP 695 >AE014297-4758|AAF57161.1| 815|Drosophila melanogaster CG11518-PA protein. Length = 815 Score = 31.5 bits (68), Expect = 0.73 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 83 HPEHHHNRLRSPYFGEDVFDTVGSGPNSP 169 HP HHHN + P G ++F G GP P Sbjct: 669 HPHHHHNPMGGP--GPNMFGGGGGGPMGP 695 >AY061041-1|AAL28589.1| 430|Drosophila melanogaster HL08023p protein. Length = 430 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 178 RELDNMLADFYRKFPTPASSSQGIEGNEYKVTIPLTSFDEKDIVVKARTGLLMVQAV 348 R L+NML D+Y + G + P +FDE+ + KA GLL+ V Sbjct: 319 RHLENMLEDYYEELGLQLIRL----GERVEQLFPRPAFDEQ-VATKAAVGLLLAMMV 370 >AE014298-1646|AAF48065.2| 430|Drosophila melanogaster CG1561-PA, isoform A protein. Length = 430 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 178 RELDNMLADFYRKFPTPASSSQGIEGNEYKVTIPLTSFDEKDIVVKARTGLLMVQAV 348 R L+NML D+Y + G + P +FDE+ + KA GLL+ V Sbjct: 319 RHLENMLEDYYEELGLQLIRL----GERVEQLFPRPAFDEQ-VATKAAVGLLLAMMV 370 >AE014298-1645|AAS65318.1| 635|Drosophila melanogaster CG1561-PB, isoform B protein. Length = 635 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 178 RELDNMLADFYRKFPTPASSSQGIEGNEYKVTIPLTSFDEKDIVVKARTGLLMVQAV 348 R L+NML D+Y + G + P +FDE+ + KA GLL+ V Sbjct: 524 RHLENMLEDYYEELGLQLIRL----GERVEQLFPRPAFDEQ-VATKAAVGLLLAMMV 575 >AE013599-302|AAF59293.1| 328|Drosophila melanogaster CG12835-PA protein. Length = 328 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 295 EKDIVVKARTGLLMVQAVHKYEGDVQKNYLDVRTLPDCVNVNGSW 429 + D+ V TG L + + +G Y D+R L C N N W Sbjct: 224 DDDVEVAMLTGSLTPSQIARIQGQQILRYDDLRNLNRCRNRNAVW 268 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,353,420 Number of Sequences: 53049 Number of extensions: 536740 Number of successful extensions: 1697 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1693 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1970722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -